SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000004294 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000004294
Domain Number 1 Region: 7-156
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.79e-35
Family Eukaryotic proteases 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000004294
Sequence length 159
Comment (Felis catus)
Sequence
IHRKDADPSAYRIHAGNVYLYGGRTLLNVSRVIVHPDYIAAFLGFDLALLKLHPRENVRT
RPVTLPLQSLDFSPEDECWLTGWGTVXXXXSLPPPYRLQEVAVSLVENAVCDQQYHNATS
HRFAGRKIIQDDMLCAGTEGRDSCQGDSGGPLVCKMTGA
Download sequence
Identical sequences 9685.ENSFCAP00000004294 ENSFCAP00000004294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]