SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000005109 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000005109
Domain Number 1 Region: 75-85,194-427
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.59e-47
Family Nuclear receptor ligand-binding domain 0.00026
Further Details:      
 
Domain Number 2 Region: 19-93
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-24
Family Nuclear receptor 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000005109
Sequence length 442
Comment (Felis catus)
Sequence
FCQDELSELDPGTNDRAEQRTCLICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSR
DKNCVMSRKQRNRCQYCRLLKCLQMGMNRKXXXXXXXXXXXXXXXXXXXISEEEIERIMS
GQEFEEEANHWSNHGDSDHSSPGNRASESNQPSPGSTLSSSRCVEINGFMAFREQYMGMS
VPPHYQYIPHLFSYSAHSPLLPPQARSLDPQSYSLIHQLVSAEDLEPLGTPMLIEDGYAV
TQAELFALLCRLADELLFRQIAWIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSK
QIFGELADVTAKYSPSDEELHRFSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAINFL
NQDIRGLTSASQLEQLNKRYWYICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNVP
LEQLPLLFRVVLHSCKTSVGKE
Download sequence
Identical sequences 9685.ENSFCAP00000005109 ENSFCAP00000005109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]