SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000006124 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000006124
Domain Number 1 Region: 35-124
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.51e-36
Family SCAN domain 0.0000426
Further Details:      
 
Domain Number 2 Region: 440-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.16e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 481-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-19
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 385-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-19
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 346-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 224-257
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000589
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000006124
Sequence length 545
Comment (Felis catus)
Sequence
MLKERPGMAEDPQQQMGVPVVKLEKELPWARGREDPSPETFRLRFRQFRYQEAAGPQEAL
RELQELCRQWLRPELHTKEQIMELLVLEQFLTILPREFYAWIREHGLESGKALVAMVEDF
TERTLEAKAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXLPVLQAGSGLPPVNRDQEMAAGFLSAGPQGLGPFKDMTLAFPE
EEWRHVTPAQIDCFGEYVEPQDCGVSPPGIGSKEKESKTQQADLKGALARVTAERFGEAT
LQSPELGRTCEQEPSSSVGNMPGPPPPQHGVIPLPNDLKTHSSFWKPFQCPECGKGFSRS
SNLVRHQRTHEEEKSYGCVECGKGFTLREYLMKHQRTHLGKRPYVCSECWKTFSQRHHLE
VHQRSHTGEKPYKCGDCWKSFSRRQHLQVHRRTHTGEKPYTCECGKSFSRNANLAVHRRA
HTGEKPYGCQVCGKRFSKGERLVRHQRIHTGEKPYHCPACGRSFNQRSILNRHQKTQHRQ
ETLAQ
Download sequence
Identical sequences ENSFCAP00000006124 9685.ENSFCAP00000006124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]