SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000006624 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000006624
Domain Number 1 Region: 33-184
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.18e-47
Family Astacin 0.00014
Further Details:      
 
Domain Number 2 Region: 495-605
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-37
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 3 Region: 656-762
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-34
Family Spermadhesin, CUB domain 0.00021
Further Details:      
 
Domain Number 4 Region: 786-845
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-17
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 5 Region: 606-648
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000167
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 451-492
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000263
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000006624
Sequence length 846
Comment (Felis catus)
Sequence
GQENAMLLQSPGTSNARAETFPPRVRRATTSRAERIWPGGVIPYVIGGNFTGSQRAIFKQ
AMRHWEKHTCVTFIERTDEESFIVFSYRTCGCWSYVGRRESPQISIWENCDFGIVAHELG
HVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLKMEAGEVSSLGETYDFDSIMHYARNT
FSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDECSWPDHGGCEQRCVNTLGSYKCACDP
GYELAADKKTCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVF
ELEGNDVCKYDFVEVRSGLSPDARLHGKFCGSEMPEVITSQSNNMRVEFKSDNTVSKRGF
RAHFFSDKDECAKDNGGCQHECVNTSGSYLCRCRNGYRLHENGHDCKEAGCAHKISSAEG
TLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHPELYDGADSLAP
ILGRFCGSKKPDPVVASGSSLFFRFYSDASVQRKGFQAVHSTECGGRLKAEVHTKELYSH
AQFGDNNYPSQARCDWVIVAEDGYGVELIFRTFEVEEEADCGYDYMEAYDGYDSTAPRLG
RFCGSG
Download sequence
Identical sequences 9685.ENSFCAP00000006624 ENSFCAP00000006624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]