SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000006843 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000006843
Domain Number 1 Region: 768-914
Classification Level Classification E-value
Superfamily C-type lectin-like 2.41e-23
Family C-type lectin domain 0.0036
Further Details:      
 
Domain Number 2 Region: 114-236
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-22
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 3 Region: 315-386
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000418
Family Kelch motif 0.021
Further Details:      
 
Domain Number 4 Region: 1048-1094
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000544
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  9685.ENSFCAP00000006843
Domain Number - Region: 85-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000659
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 234-271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00272
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 535-582
Classification Level Classification E-value
Superfamily Kelch motif 0.00327
Family Kelch motif 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000006843
Sequence length 1414
Comment (Felis catus)
Sequence
MVEAGAATKARKSRTAETALAGRNVGQRDDATGVGSPGLGAGLRLPQLLLQLLLLLPPPL
LLLPWAAEAAAAASAVSGSAAAEAKECDRPCVNGGRCNPGTGQCVCPTGWVGEQCQHCGG
RFRLTGSSGFVTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATECSWDHLYVYDGDSI
YAPLVAAFSGLIVPERDGNETVPEVVATSGYALLHFFSDAAYNLTGFNITYNFDMCPNNC
SGRGECKISNSSNTVQCECSENWKGEACDIPHCIQDCGFPDRGICNSSDVRGCSCFPDWQ
GPGCSIPVPANQSFWTREEYSNLKLPRASHKAVVNGNIMWVVGGYMFNHSDYNMVLAYDL
ASREWLALNRSVNNVVVRYGHSLALYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTILKDSRFFR
YLHTAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXTMVFGGVNNLLLRDILVFSEQQCEAHLIEAACLSTCHGLRCQWDTGSSQC
ISWELATEAQEEKLKSECFSKGTLDHDRCDQHTDCYSCTANTNDCHWCNDHCVPVNHSCT
EGQISISRYENCPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQECIALPENICGIGWHLV
GNSCLKITTAKENYDNAKLSCRNHNAFLASLTTQKKVEFVLKQLRIMQSSQSMSKLTLTP
WVGLRKINVSYWCWEDMSPFTNSLLQWMPSEPSDAGFCGILSEPSTRGLKAATCINPLNG
SVCERPANHSAKQCRTPCALRTACGECTSGSSECMWCSNMKQCVDSNAYVASFPFGQCME
WYTMSSCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGSYKGPVKMPSQAPVGN
SYPQPLLNSSMCLEDSRYNWSFIHCPACQCNGHSKCINQSICEKCENLTTGKHCETCISG
FYGDPTNGGRCQPCKCNGHASLCNTNTGKCFCTTKGVKGDECQLCEVENRYQGNPLKGTC
YYTLLIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFINASKNFNLNITWAASFSA
GTQAGEEMPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNFTWPIKIQXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLLREMQQMASRPFASVNVAL
ETDEEPPDLIGGSIKTVPKPIALEPCFGNKAAVLSVFVRLPRGLGGIPPPGQSGLAVASA
LVDISQQMPIVYKEKSGAVRNRKQQPPAQPGTCI
Download sequence
Identical sequences ENSFCAP00000006843 9685.ENSFCAP00000006843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]