SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000007664 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000007664
Domain Number 1 Region: 44-233
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.16e-51
Family Eukaryotic proteases 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000007664
Sequence length 235
Comment (Felis catus)
Sequence
ILRWLRVKSLDLSHTAKEPGACPSPLQAMMILRLIILALVTGHVGGETRIIKGYECSPHS
QPWQVALFQKTRLLCGATLIAPKWLLTAAHCRKPRYLVHLGEHNLQLAGWAVXLTLSSRC
VAPGTRCLISGWGTTSSPQLHLPHTLRCANITIIKHEECENAYPGNIXXXXXXXXXXXXX
XXXXXSDSGGPLVCDGSFQGIISWGQDPCAVTRKPGVYTKVCKYVDWIQKTMEDN
Download sequence
Identical sequences ENSFCAP00000007664 9685.ENSFCAP00000007664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]