SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000008463 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000008463
Domain Number 1 Region: 470-583
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000000000447
Family Nuclear receptor ligand-binding domain 0.000087
Further Details:      
 
Domain Number 2 Region: 633-676
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.000000223
Family Nuclear receptor ligand-binding domain 0.00023
Further Details:      
 
Weak hits

Sequence:  9685.ENSFCAP00000008463
Domain Number - Region: 735-775
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0249
Family Nuclear receptor ligand-binding domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000008463
Sequence length 777
Comment (Felis catus)
Sequence
MDSKESLSPPSKEEISSSVLGRERGNVMDFYKTLRGGASVKVSASSPSLAAVSQSDSKQQ
RLLVDFPKGSGSNAQQPDLSKAVSLSMGLYMGETETKVMGNELGFPQQGQISLSSGETDF
QLLEESIANLNRSTSVPENPKSSATVAVAAAPTEEFPKTLSDVSSEQQNLKGQTGTNGGN
VEWYTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYDMNTASLSQQQDQKPIFNVIPPIPVG
SENWNRCQASGDDNLASLGTLNFPGRSVFSNGYSXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQHNYLCAGRNDCIIDKIRRKNCPACRYR
KCLQAGMNLEARKTKKKVKEIQQTPTKCPQETPENPANKRVVPATLPQLTPTLVSLLEVI
EPEVLYAGYDSSIPDSTWGIMTTLNMLGGRQVIAAVKWAKAIPXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHRMSLPCMYEQCKHMLYVSSELHRLQVS
YEEYLCMKTLLLLSSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVVENLLNFCFQTFNKTMSIEFPEMLAEIITNQIPKYSSGNIKKLLFHQK
Download sequence
Identical sequences ENSFCAP00000008463 9685.ENSFCAP00000008463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]