SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000008586 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000008586
Domain Number 1 Region: 9-164
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 5.36e-67
Family TRADD, N-terminal domain 0.000000126
Further Details:      
 
Domain Number 2 Region: 220-308
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000706
Family DEATH domain, DD 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000008586
Sequence length 311
Comment (Felis catus)
Sequence
MASGPNGLEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALRTALAESVGSPEMLQ
MLKIHRSEPQLIVQVRFCGRQPCSRFLRAYREGALRAALQGCLAAALAQHSVPLELELRA
GVERLDTLLTDEERCLSCIFAQKPDRLRDDELSELEDALRNLTCGSGGQGSDVEVAPVPS
QSLDASFSDEKPPPPPSGQTFLFQGQPIVNRPLSLQDQQTFARSVGLKWRKVGRSLQRGC
RALRDPALDSLAYEYERDGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDL
LGLANPDGGLA
Download sequence
Identical sequences ENSFCAP00000008586 XP_003998167.1.62641 XP_019675453.1.62641 XP_019675454.1.62641 9685.ENSFCAP00000008586 ENSFCAP00000020955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]