SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000010528 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000010528
Domain Number 1 Region: 38-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.19e-21
Family SCAN domain 0.0038
Further Details:      
 
Domain Number 2 Region: 344-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 305-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000324
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000010528
Sequence length 429
Comment (Felis catus)
Sequence
MDLDFRTSFLCDPSMDNLGSGNKDFKPSQGPALQKAEEISELQDTQHSLFQNGNNSFAKQ
ELQRLYKSFYLWLQPEKHSKDEIIFQVVLEQFMINRHCSDRSTLKEKWESGGRNLEKFME
GLSDGCMKPPGLVHVHMQGQEALFSENMPLREVIVHLAKQLSAGTPTGENMGTPSCTPQD
TSLATGRGDEDKENGGNIDQVNDRITSQGNAIPSLLIIQEEGCPRPEDDSVSLKNPVNSG
RAGLAISGSQEGCPKGPPYQDILMEVGPGFLSQPVKVTPEPVPTHQNEGISTCEGLQERS
HEAPKPYRCEKCPKIFRYFSQLKAHQRRHNNERTFICAECNKGFFQASDLHVHQMIHVKK
KPFTCSTCEKSFSHKTNLKAHERIHTGEKPYACSLCRRSYRQSSTYHRHLRTHQKMTFKS
APSTPEASS
Download sequence
Identical sequences ENSFCAP00000010528 9685.ENSFCAP00000010528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]