SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000010876 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000010876
Domain Number 1 Region: 1031-1113
Classification Level Classification E-value
Superfamily Immunoglobulin 1.81e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 2 Region: 1117-1203
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-18
Family I set domains 0.031
Further Details:      
 
Domain Number 3 Region: 724-783
Classification Level Classification E-value
Superfamily BPTI-like 1.91e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0021
Further Details:      
 
Domain Number 4 Region: 893-973
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000568
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 279-337
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000353
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 6 Region: 343-401
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000719
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 7 Region: 400-457
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 8 Region: 31-61
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000129
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000010876
Sequence length 1261
Comment (Felis catus)
Sequence
MQAEIRMFLLVPLLLAPAPGSSAPKVRRQSDLWGPWGSWGPCSRTCGGGISFRERPCYSQ
XXXXXXXXXXXXXXXXXXXXXSCPTGARDFRAEQCAQFDGQDFQGKRYKWLPYYGAPNKC
ELNCIPKGENFYYKHREAVVDGTPCEPGKRDVCVEGSCRAVGCDHNLDSSKEEDKCLQCG
GDGTTCYPXXXXXXXXXXXXXVKSIRGEYYLNGHWTIGGAWALPVASTVLHYERGAEGDL
APERLLARGPTSEPLVIELLSQEPNPGVSYEYHLPLGSPRPGFHWSHGSWSDCSTECGGG
HQSRPVFCTTDNEVYPDHMCQPQLRPTDHRPCSTHPCPQTKRWKTGPWSPCSASCGGGSQ
SRSVYCVLSDGAGVQEATEEAGCAGLPGKPPTVRPCNLQRCASWSAEPWGECSVSCGAGI
RKRSVTCRGDEGSLLQATACSLEDRPPVSEPCAHEDCPXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPSMQDMHSSPGDPRISLGP
QAAPTSDSRGQWWARQEQPSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYGCCPDGVSVAEGPHQAGCAA
SYSSDKTGRRPVSRAVASTAPKAHQPQAQQKEPSECQGSRFGCCYDNVASAAGPLGEGCV
GQPSYAYPVRCLLPSAHGSCTDWAARWYFVPSVGQCNRFWYGGCHGNGNNFASEEECVSS
CRGRQQEPPRPEPGASGQSTHRDGGGSGPGGQQEAGGHRTGATVQTRPLPSGGLWWRDRE
PGPGEEGHAQAFGERPLGQELGPSAPGLGGDAGRPAAPSHSSSYRISLAGSEPALVQAAL
GHLVRLFCQDDTSPEPHARWQKDGRPISSDRHKLQPDGSLVISPLRAEDTGTYSCGSSRP
GRDSQKIQLRVTGGDVAVLSEAEPRHFPQTRDPAQGHSPRESSLVGNAGGLGAVSSLQIR
PTTRLLLDRNQPRVVDARPGQRIRLTCRAEGFPPPAIEWQRDGQPLSSPRHQLQPDGSLV
ISHVAPEDGGFYACVAFNGQDRDQRWVQLRVLGELAITELPSTMLVPEGDTARLLCVVTG
ESVNIRWSRNGLPVRADGHRVYQSPDGTLLIHNLQPRDEGSYTCSAYRGSQAVSRSTEVK
VGPPALAAQSRDLSRECMDQPELANCDLILQAQLCGNEYYSSFCCASCSRFQPHARPVWQ
Q
Download sequence
Identical sequences ENSFCAP00000010876 9685.ENSFCAP00000010876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]