SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000012026 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000012026
Domain Number 1 Region: 30-226
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.37e-57
Family Prokaryotic proteases 0.0000000161
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000012026
Sequence length 231
Comment (Felis catus)
Sequence
LLLLWGEGRGPPAVLASVLGSPPTSPRSQYNFIADVVEKTAPAVVYIEILGRHPFSGREV
PISNGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAMVTAVDPVADIATLRIQTK
EPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQT
DAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKK
Download sequence
Identical sequences 9685.ENSFCAP00000012026 ENSFCAP00000012026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]