SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000012522 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000012522
Domain Number 1 Region: 13-201
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.28e-53
Family Eukaryotic proteases 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000012522
Sequence length 204
Comment (Felis catus)
Sequence
MQPLLLLLTFLLASKAEAGKIIGGHEANPHSRPYMAFLDLQDKTWKQCGGFLVREDFVLT
AAHCWGSAMTVTLGAHNIKKKESTQQSIPVRQIIRPSGYTSETFLNDIMLLQAKKLHEVE
LEIQKDEQCMSHYHHLYNPATQMCVGNPRRKKSALQGDSGGPLVCNNVAQGIVSCVKHCG
TPPLVYTRISGFMHWIEKIMRHFS
Download sequence
Identical sequences ENSFCAP00000012522 9685.ENSFCAP00000012522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]