SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000013156 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000013156
Domain Number 1 Region: 171-368
Classification Level Classification E-value
Superfamily PH domain-like 5.9e-23
Family SSRP1-like 0.00075
Further Details:      
 
Domain Number 2 Region: 447-520
Classification Level Classification E-value
Superfamily HMG-box 0.00000288
Family HMG-box 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000013156
Sequence length 608
Comment (Felis catus)
Sequence
NGNWLKLRLLGVIFKDSKTDKVDNIQAGALMEAIYNVVLDHGLKLLKKNSQVYKYDGIED
LGNSDFFETHCCLELMEEVLFMKGRSGTVNFGGLLPSFDIDGRLLFEILLSNMSQCTTGK
NEVTPEFHQNVDVKISLTEVHFCGSPTLEDDVDLFEAFAQYMKMYIILDIEYIFQKLQCV
TSLDRENIWIYPNLLHLHSKFFDYKIPYIMILNLFSLLCNDQHQRLFVISLNLPIRQDQT
CHFLTLLFPRNKDIFLTPIMKKEEEKPFARQITKNMSRCLQEVNRVMKTLVNHKFPGNFQ
GCIICSCKAGSRLSHLPEQFIYVHKPPVYICFDKISFVNFACGSTPTCSFDFDIETKQGT
FRSIERVNQNYSEGSNCDEEESHAHLNLIKTYLENAINGRDDSRAGTFDSKPSASSSNNE
DDSACSEKRKHLKKTKNHKGCKKPLEKRKDLSAPKRHVYAMLWLDLEEKIKSDRLNISIM
KLSKKANETWRGMSKEKKDKWDFKAEGTREYDKAMREHKGVHGESSKRDKSKKKKRKLNV
GKKSMPSRSSLSKSFSRQLSEAFKKSVSCEDNFSGKNQSKKKKTSDSEEEELVSTSSSED
CVTGSDKQ
Download sequence
Identical sequences 9685.ENSFCAP00000013156 ENSFCAP00000013156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]