SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000013637 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000013637
Domain Number 1 Region: 366-415
Classification Level Classification E-value
Superfamily UBA-like 1.4e-17
Family UBA domain 0.00012
Further Details:      
 
Domain Number 2 Region: 92-152
Classification Level Classification E-value
Superfamily RING/U-box 2.47e-17
Family ZZ domain 0.011
Further Details:      
 
Domain Number 3 Region: 25-77
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000174
Family PB1 domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000013637
Sequence length 419
Comment (Felis catus)
Sequence
FCFSPEPEAEAEAEAEVAAGPGPCERLLSRVAALFPALRPGGFQTHYRDEDGDLVAFSSD
EELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRGMVHPNVICDGCNGPVVGTRY
KCSVCPDYDLCAACEGKGLHREHNKLVFPTTFGPFSEGFSHSRWLRKLKHGHFGWPGWEM
GPPGNWSPRPPRAGDARPSPAAESASGPSEDPSVNFLKNVGESVAAALSPLGIEVDIDVE
HGGKRSRLTPVSPGSSSTEEKCSSQPSSCSSDPSKPDGDTEGAARSLAEQMDKIALEPGQ
PEEQMESDNCSGGDEDWTHLSSKEVDPSTGELQSLQMPESEGPASLDSSQEGPTGLKEAA
VYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPLPL
Download sequence
Identical sequences 9685.ENSFCAP00000013637 ENSFCAP00000013637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]