SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000013910 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000013910
Domain Number 1 Region: 147-370
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.59e-59
Family Nuclear receptor ligand-binding domain 0.000000000876
Further Details:      
 
Domain Number 2 Region: 68-141
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.22e-19
Family Nuclear receptor 0.0000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000013910
Sequence length 370
Comment (Felis catus)
Sequence
MEQKPSKVECGSDPEENSARSPDGKRKRKNGQCSLKTSMSXXXXXXXXXXXXXXXXXXXX
XXXXXXXXTCEGCKGFFRRTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGM
AMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHVATEAHRSTNA
QGSHWKQRRKFLPDDIGQSPIVSMPDGDKVDLEAFSEFTKIITPAITRVVDFAKKLPMFS
ELPCEDQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIF
ELGKSLSAFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNI
PHFWPKLLMK
Download sequence
Identical sequences ENSFCAP00000013910 9685.ENSFCAP00000013910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]