SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000014435 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000014435
Domain Number 1 Region: 168-425
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.15e-79
Family Eukaryotic proteases 0.00000000339
Further Details:      
 
Domain Number 2 Region: 51-162
Classification Level Classification E-value
Superfamily Kringle-like 7.25e-33
Family Kringle modules 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000014435
Sequence length 433
Comment (Felis catus)
Sequence
MRILMTCLLLCVLVVSDSEGSHELHPVSDASNCGCLNGGTCVSYKYFSNIQRCSCPKKFQ
GEHCEIDTSKTCYQGNGHSYRGKANTDIVGRPCLAWNSAAVLLKEYHALRSDALQLGLGK
HNYCRNPDNQRKPWCYVQVGLNQLVQQCMVHDCSFGKKSPSPPKTAEFQCGQKALRPRFK
IIGGEFTTIENQPWFAAIYRRHRGGSVTYLCGGSLISPCWVVSATHCFINNPKKEDYIVY
LGRSKLNSDTLGQMKFEVENLILHEDYSADTLAHHNDIALLKIRSNTGQCAQPSRSIQTI
CLPPSYGDAHFGTSCEITGFGKENTTDYLYPEQLKMTSVKLISYQECQQPHYYGSEITTK
MLCAADPQWETDSCQGDSGGPLVCSIHGRLTLTGIVSWGSGCAMKDKPGVYTRVSGFLPW
IQRHTGEQNGLDL
Download sequence
Identical sequences ENSFCAP00000014435 9685.ENSFCAP00000014435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]