SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000014576 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000014576
Domain Number 1 Region: 2208-2301
Classification Level Classification E-value
Superfamily C-type lectin-like 5.95e-33
Family Link domain 0.0001
Further Details:      
 
Domain Number 2 Region: 1472-1520,1598-1712
Classification Level Classification E-value
Superfamily FAS1 domain 1.28e-28
Family FAS1 domain 0.0022
Further Details:      
 
Domain Number 3 Region: 508-646
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-28
Family FAS1 domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1712-1867
Classification Level Classification E-value
Superfamily FAS1 domain 9.29e-26
Family FAS1 domain 0.0059
Further Details:      
 
Domain Number 5 Region: 385-500
Classification Level Classification E-value
Superfamily FAS1 domain 8.76e-21
Family FAS1 domain 0.0056
Further Details:      
 
Domain Number 6 Region: 964-1121
Classification Level Classification E-value
Superfamily FAS1 domain 1.96e-20
Family FAS1 domain 0.004
Further Details:      
 
Domain Number 7 Region: 2299-2461
Classification Level Classification E-value
Superfamily FAS1 domain 2.35e-16
Family FAS1 domain 0.0075
Further Details:      
 
Domain Number 8 Region: 1129-1253
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000955
Family FAS1 domain 0.008
Further Details:      
 
Domain Number 9 Region: 1544-1581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000921
Family Merozoite surface protein 1 (MSP-1) 0.055
Further Details:      
 
Weak hits

Sequence:  9685.ENSFCAP00000014576
Domain Number - Region: 805-904,933-988
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000115
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number - Region: 230-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00227
Family EGF-type module 0.072
Further Details:      
 
Domain Number - Region: 275-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0263
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 1422-1454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0909
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 198-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0963
Family Merozoite surface protein 1 (MSP-1) 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000014576
Sequence length 2571
Comment (Felis catus)
Sequence
MAGPRGRLLLCLLAFCLAGSSFTRGQKVRSRRCDVKTKFVMRIPCTMCPAIKRRMCPPGW
LRELPEKISQDCRYEVQLGDSLMSMSGCSMECWKDVVEKACCPGYWGSQCYECPGGAETP
CNGRGTCLDGIDGNGTCVCQEFSGSSCQECQDPSRFGPNCQSVCSCVHGVCSHGPLGDGS
CLCFAGYTGARCDQELPICQALNCPQNSQCSAEAPACSCLPGHTQQGRECRAPNPCQPSP
CSPLAQCSVSPTGQAQCRCPKDYHGDGTVCLPHDPCTINHGGCPINSTVCLYLRSGKASC
QCKPGLVSINHNASAGCFAYCFPHSCDRSATCQVTSDGKTSCVCKEGEVGDGRACYGHLL
HEIQKASQLGVVFLRLRVTLAMLDQGCREILTTSGPFTVLVPSLSSVFSRTMNASVARQL
CKQHIIAGQHILEELGTQQTRRWWTLDGQELTVTFNHFMKYTYKYKEHPQQTFTIQKANY
PAANGVFHLVTALQWQPPPELPEDPKRTIGQILASTEAFSRFETILENCGLPSILDGPGP
FTVFVPSNEAVDMLRDGRLIYLFTAGLSKLQELVKYHIYSHGQLTIEKLISKGRVLTMAN
QVLAVNISEEGRILLGPEGVPLRRVDVLAANGVIHMLEGVLLPPTILPILPKHCNEEQYK
IVAGSCVDCQALNTSMCPPNSMKLDIFPKECVYTHDPTGLNVLKKGCAHYCNQTILKPGC
CKGFFGPDCIQCPGGFSNPCYGKGTCSDGVRGNGACLCFPDYKGIACHICSNPNKHGDQC
QEDCGCVHGLCDNRPGSGGVCQRGTCAPGFSGHFCNESSVNCGPTERAQSCHLHARCVSQ
GGVTRCVCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGALGNHHCTCHKGWSGDGR
VCVAIDECELDVRGGCHADALCSYVGPGQSRCTCKLGFAGDGYVCSPIDPCRAGNGGCHD
LATCQAVGGGQRVCTCPSGYGGDGFNCYGDIFRELEANAHFSVFYQWIKSAGITLPTDSR
VTALVPSESAIRRLSPEDQAFWLQPRMLPHLVRAHFLQGALSEEELARLAGQDVATLXXX
XXXXXXXXXXRVWVQNASVDVADLLATNGVLHVLSQVLLPPRGDALHGQGLLQQLDSVPA
FHLFRELLQHHSLVPQIEAATAYTIFVPTNRSLEAQGNSSILDADTVRHHVILGEALSTE
SLQKGGHRNSLLGPAHWLVFYNHSGQPEVNHMPLEGPVLEAPGRSLFGLSGVLTVGSSRC
LHSHAESLREKCINCTRKFRCTQGFQLENTPRKSCVYRSGYSFSRGCSYTCAKKIQVPDC
CPGFFGTLCEPCPGGLGGVCSGHGQCQDRLLGSGECHCHEGFHGTACEMCELGRYGPTCA
GVCDCAHGLCQEGLQGDGSCVCHAGWQGPRCDQKISGPQCPKKCDPNANCVQDSATAPAC
VCAAGYSGDGVHCSEVDPCARDHGGCSPHANCTKVAPGQRTCTCQDGYTGDGELCQEVNS
CLIHHGGCHMHAECIPTGPQQVSCSCREGYSGDGIRTCELLDPCSQSNGGCSPYAVCKST
GDGQRTCTCDAAHTVGDGFTCRARVGLELLRDRHASFFSLHLLEYKELKGDGPFTVFVPR
ADLMSNLSQDELAPIRAHRQLVFRYHVVGCRQLRSQELLDEGYVTTLSGHTLRIHEREGS
IYLNDFARVVSSDHEAVNGVLHFIDRVLLPPDVLYWKPDVAPILRRNVTAAAESFGYKIF
SGLVKVAGLLPLLQDAAHRPLTMLWPTDSALQALPPDRQAWLYHEDHRDKLAAILRGHVI
RNIEALASDLPNLGPLRTMHGTPISFSCSRVRPGELTVGEEDARIMQRHLPFEGGLAYGI
DQLLEPPGLGARCDRFETRPLRLKICSICGLEPPCPEGSREQGSPETCWRYYSKFWTSPP
LHSLALRSIWARSSLWGQPQGLGRGCHRNCVTTTWKPSCCPGHYGSECRACPGGASSPCG
GHGVCMDGMSGSGQCQCHARFTGTACELCASGAFGPQCQACRCTSHGRCDEGLGGSGSCF
CDEGWTGPSCEVQLKLQPVCAPPCAPEAVCRAGNSCECGLGYEGDGRSCTVADLCLDGHG
FCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTRRC
VCHAGYVGDGLQCLEEPEPPVDRCLGQPPPCHVDAVCTDLHFQEKQAGVFHLQAPSGPYG
LNFSEAKAACGAQGAVLASLPQLSAAQKLGFHLCRVGWLANGSAAHPVVFPAADCGGGQL
GVISLGLRKNHSERWDTYCYREQDVACRCRQGFVGDGTSVCNGKLLDVLAATANFSTFYG
MLLGYANATPRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNTTFLSTN
ASQDTVLPAHSGLSLFFSAVGPDNSSWAPVAPGAVVVSHVVVWDIMAFNGIIHALARPLL
APLQPQAAVAPEGPPVVAGVGAVVAAGALLGLVAGAFYLRARGQATGFGFSTFQAEDDAE
DDFSPWQEGTSPTLVSVPNPVFGSPDAFGEPFDDSLLEEDFPDTQRILTVK
Download sequence
Identical sequences 9685.ENSFCAP00000014576 ENSFCAP00000014576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]