SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9685.ENSFCAP00000015382 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9685.ENSFCAP00000015382
Domain Number 1 Region: 153-241
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 9.68e-32
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000181
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily PH domain-like 3.16e-18
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00076
Further Details:      
 
Domain Number 3 Region: 256-311
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.000000000458
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9685.ENSFCAP00000015382
Sequence length 311
Comment (Felis catus)
Sequence
AGQLLWEQELYSQLVYSTPTPYFHTFAGDDCQAGLNFADEGEAQAFRALVQEKIQKRNQR
QSGDRRQLPPPPAPANEERRGPPPLPPHPGGDQGXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVSHVGWDPQNGFDVNNLDPDLRSLFS
RAGISEAQLTDAETSKLIYDFIEDQGGLEAVRQEMRRQPQXPPPPPPPPPPPSSDDGPVP
PPPPALGPVGGLAPSGGRGALLDQIRQGIQLNKTPGAPESSALQPPPPRSEGLVGALMHV
MQKRSRAIHSS
Download sequence
Identical sequences ENSFCAP00000015382 9685.ENSFCAP00000015382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]