SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000001681 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  9796.ENSECAP00000001681
Domain Number - Region: 21-132
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00131
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000001681
Sequence length 174
Comment (Equus caballus)
Sequence
MRRQRNTFQAREQDKTPEKGQNEREVSTLHDKEFKQNLIRMLTDIERRLDEHSKLISKEL
ENIKKNQSEMKNTVLEIKNSLEGFNGRVEDAEEWISELDKRLEEITQAEKEKEKRIRQNE
NSLRELWDNIKDTNIGIIGVSEGEERDKGAENLFEEIIDENLPNLRMETDIQVQ
Download sequence
Identical sequences F6T2W8
ENSECAP00000001681 ENSECAP00000001681 9796.ENSECAP00000001681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]