SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000003819 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000003819
Domain Number 1 Region: 91-172
Classification Level Classification E-value
Superfamily HMG-box 8.64e-21
Family HMG-box 0.0000306
Further Details:      
 
Domain Number 2 Region: 213-309
Classification Level Classification E-value
Superfamily HMG-box 5.76e-20
Family HMG-box 0.0000315
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000003819
Sequence length 388
Comment (Equus caballus)
Sequence
MALRESQDHWSKEDIVKLLERMENNLPSNERHTFKTTQSQMDWGKVAFKDFSGEMCKLKW
VEISYTLRKFRTLKELVLEAKEHAKKLSKSKKHRKHPDFPKKPLTAYLRFFKERRPQCSQ
MHPTLSNQQLTKLLSEEYRELPEQVKLKYIQDFQKEKQEFEEKVARFREAHPALVQNSKK
SNVPKRSPTKAPKKMQGSEKEVKSSPQTSFSQKMKFHGEPKKPPMHEYQKFHEDLWSSRE
LQDLPLRERMVEIGRRWQRIPQSQKEHCKKQAEELQKQYKVDLDRWLQSLSPEEYAAYRE
ATYTKRKNLGMRGGSNPKIRRTDLPSPSARSPQEGLGEEQELQASETESSESVGVTSLSS
LGSEDNKEDGEEEEGRNSSDSSSEEEDG
Download sequence
Identical sequences F6ST96
ENSECAP00000003819 ENSECAP00000003819 9796.ENSECAP00000003819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]