SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000004256 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000004256
Domain Number 1 Region: 3-145
Classification Level Classification E-value
Superfamily UBC-like 1.19e-42
Family UEV domain 0.000000157
Further Details:      
 
Domain Number 2 Region: 323-383
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 3.79e-21
Family VPS23 C-terminal domain 0.0037
Further Details:      
 
Weak hits

Sequence:  9796.ENSECAP00000004256
Domain Number - Region: 236-313
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00476
Family FCH domain 0.054
Further Details:      
 
Domain Number - Region: 150-210
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00994
Family beta-sandwich domain of Sec23/24 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000004256
Sequence length 390
Comment (Equus caballus)
Sequence
MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVVDSYVFNDGSSRELMNLTGTIP
VPYRGNIYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSYMPGMPSGISAYPSGYPP
NPSGYPGCPYPPGGQYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRW
RMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLRKKDEELSS
ALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFL
KHVRLLSRKQFQLRALMQKARKTAGLSDLY
Download sequence
Identical sequences F6ZA94
ENSECAP00000004256 ENSECAP00000004256 9796.ENSECAP00000004256 XP_001505015.1.31192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]