SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000004320 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000004320
Domain Number 1 Region: 633-834
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-46
Family SPRY domain 0.0000439
Further Details:      
 
Domain Number 2 Region: 5-94
Classification Level Classification E-value
Superfamily RING/U-box 2.14e-27
Family RING finger domain, C3HC4 0.0056
Further Details:      
 
Domain Number 3 Region: 340-421
Classification Level Classification E-value
Superfamily RING/U-box 8.39e-25
Family RING finger domain, C3HC4 0.0069
Further Details:      
 
Domain Number 4 Region: 90-154
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.21e-16
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Domain Number 5 Region: 423-488
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000916
Family B-box zinc-binding domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000004320
Sequence length 836
Comment (Equus caballus)
Sequence
AAMASEILMNIKEEVTCPICLELLTEPLSLDCGHSFCKACITANNRDSKIGQEGESSCPV
CRISYQLGNLRPNRPMANIVERLREVKLNPEEKQKRDLCVRHEEKLLLFCKEDGKIICWL
CERSQEHRGHHTFLMEEVAQEYQKKLQTALERLRKEQQRAESLEADVREERTSWKSQEAH
FLFNKMQNEKKSVQAEFNQVRVFLDSEEQKELLKLNKEEADILHHLAEAENELVQQKQLV
SALISDLEHRLQGSTMEMLQHVNDIMKRSKTLTVRKPKTLPVEQKRVCRVPDLRGILQAF
NELTDVRRYWSKEGNLDSRTRRAPGVRTRGSKGRIAMDFSAQVNLQKEVTCPMCLELLTE
PLSLDCGHSFCQACITAKIKESVIHLGGECSCPVCQRRYQPGNLRPNPHLATIVERVREV
NTSPHKWQKRDLCEHHGEKLHLFCKNDAKAICRLCVPSLEHQGHQIFFMEKAVMEIQDKL
QGALKKLKKEQQEAEELEADVREERATWKAGRDFFLREQRILKGFNEMRGILDSLEQKEL
RKLEEDEVTVLENLVAAKDQLVQQSQYIKELIAELERQTCVSSIDTLQDVNNLIRRSETW
TLKKPKMVSKKLKRAFRVPDLSGMLKVFKDLTEIQCYWVDVMLNPINAISSIIVSADQRQ
VRVVHPFMFGNIFPCDLSAFDILGCQSFSSGKYYWEVDVSGKTAWILGVCSNKRKFNRQK
SSGFAFESNLNHPNVYSRYTPQHGYWVVGLQNESEYNAFEDSSTSDPKVLTISMAVPPHR
VGVFLDCEGGTVSFFNVTNHGSLIYKFSKCRFSDPSYPYFNPWNCPAPMTLCPPSS
Download sequence
Identical sequences F7B6K6
ENSECAP00000004320 9796.ENSECAP00000004320 ENSECAP00000004320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]