SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000004494 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000004494
Domain Number 1 Region: 29-130
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-23
Family Spermadhesin, CUB domain 0.0000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000004494
Sequence length 138
Comment (Equus caballus)
Sequence
LLVFSTSPWQQLLSTASALVSTAQNKGYSDCGGLLTDLSGRISNYIGPKTVCVWTIQMTP
GLHVAMAIPGLNLTCLKEYVEIQDGPPGSASYGKICEGLGLTFRSSSNILTVKYTRKPDH
PASSFDVYYYGEPEGSRG
Download sequence
Identical sequences F7A3N5
ENSECAP00000004494 ENSECAP00000004494 9796.ENSECAP00000004494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]