SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000005073 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000005073
Domain Number 1 Region: 54-518
Classification Level Classification E-value
Superfamily Sema domain 1.83e-156
Family Sema domain 0.0000000861
Further Details:      
 
Domain Number 2 Region: 514-562
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000645
Family Plexin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000005073
Sequence length 631
Comment (Equus caballus)
Sequence
MRSEALLLYFTLLHFAGAGFPEDSEPISISHGNYTKQYPVFVGHKPGRNTTQRHKLDIQM
IMIMNRTLYIAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNF
IKVLLKKNDDTLFVCGTNAFNPSCRNYKMDTLEPFGDEFSGMARCPYDAKHANVALFADG
KLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIA
VEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVT
DVIHINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDER
VPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRL
TKIAVDTAAGPYQNHTVVFLGSEKGIILKFLARIGNSGFLNDSLFLEEMSVYNPEKCSYD
GVEDKRIMGMQLDKASSSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVKEGG
SCAHLSPGSRLTFEQDIERGNTDGLGDCHNSFVALNGHSSSLWPSTTTSDSAAQEGYESR
GGMLDWKDLLDSPDSTDSLGAVSSHNHQDKK
Download sequence
Identical sequences F7E2H5
ENSECAP00000005073 ENSECAP00000005073 9796.ENSECAP00000005073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]