SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000007382 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000007382
Domain Number 1 Region: 521-748
Classification Level Classification E-value
Superfamily SET domain 1.22e-61
Family Histone lysine methyltransferases 0.0021
Further Details:      
 
Weak hits

Sequence:  9796.ENSECAP00000007382
Domain Number - Region: 435-474
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000274
Family Myb/SANT domain 0.022
Further Details:      
 
Domain Number - Region: 120-173
Classification Level Classification E-value
Superfamily CalX-like 0.017
Family CalX-beta domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000007382
Sequence length 758
Comment (Equus caballus)
Sequence
SKMDIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNE
EWKKLRVQPVQLMKPVSGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPLQ
QNFMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLE
LVDALNQYSDEEEEGHNDTSDGKQDDGKEDLPVTRKRKRHAMEGNKKSSKKQFPNDMIFS
AIASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLF
CRRCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCS
GRRRRRHHMVSASCSNTSASAVAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPA
PPQLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLI
LKLPTDELMNPSQKKKRKHRQGLDKGHFLLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDR
PCDSTCPCIMTQNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTC
GASEHWDCKVVSCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQ
DEADRRGKVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRI
GIFAKRAIQAGEELFFDYRYSQADALKYVGIERETDVL
Download sequence
Identical sequences F6WSU9
ENSECAP00000007382 9796.ENSECAP00000007382 ENSECAP00000007382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]