SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000007802 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000007802
Domain Number 1 Region: 107-180
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.92e-18
Family Complement control module/SCR domain 0.00026
Further Details:      
 
Domain Number 2 Region: 232-293
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000459
Family Complement control module/SCR domain 0.00075
Further Details:      
 
Domain Number 3 Region: 171-240
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000459
Family Complement control module/SCR domain 0.00046
Further Details:      
 
Domain Number 4 Region: 44-117
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000249
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000007802
Sequence length 295
Comment (Equus caballus)
Sequence
MTASCARRGAPLCRPESHFSSWCSVGILLGALVLPLPVSPSDACGDPPRYQSMKLKGVAQ
PPYSPGATIEYECRLGYKLKRPPLPTSAICQANNTWTPLQEACTRKLCPHPVEPVNGAVQ
HVNETLEFGSQVHYVCNEGYNLIGTKILYCELDGENVNWSDNPPLCEVMRCRPPPKIQNG
KYSITDQEDFRYGEVVTYSCDPANGPDEYSLVGESKLVCSGNDVWSSKPPECKVVKCKYP
VLENGRIVSGFGSKFYYKAMVVFECVPGFYLSGNNTIVCGANSTWEPAIPKCIKG
Download sequence
Identical sequences F6ZPI6
ENSECAP00000007802 9796.ENSECAP00000007802 ENSECAP00000007802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]