SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000008096 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000008096
Domain Number 1 Region: 203-470
Classification Level Classification E-value
Superfamily Kelch motif 4.32e-43
Family Kelch motif 0.0063
Further Details:      
 
Domain Number 2 Region: 562-731
Classification Level Classification E-value
Superfamily C-type lectin-like 5.07e-26
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 3 Region: 868-914
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000023
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 4 Region: 2-62
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000131
Family Spermadhesin, CUB domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000008096
Sequence length 1234
Comment (Equus caballus)
Sequence
MYVYDGDSIYAPLIAVLSGLIVPEIRGNETVPEVVTTSGYALLHFFSDAAYNLTGFNIFY
SINSCPNNCSGHGKCTTSISVPSQVYCECDKYWKGEACDIPYCKANCGSPDHGYCDLTGE
KLCVCNDSWQGPDCSLNVPSTESYWILPNVKPFSPSVGRASHKAVLHGKFMWVIGGYSFN
YSSFQMVLNYNLESSIWNVGTLSRGPLQRYGHSLALYEENIYMYGGRIETNDGNVTDELW
IFNIHSQSWSTKSPTVLGHGQQYAVEGHSAHIMELDSRDVVMIIIFGYSAIYGYTSSIQE
YHISSNTWLVPETKGAIVQGGYGHTSVYDEITKSIYVHGGYKALPGNKYGLVDDLYKYEV
NTKTWTILKESGFARYLHSAVLINGAMLIFGGNTHNDTSLSNGAKCFSADFLAYDIACDE
WKILPKPNLHRDVNRFGHSAVVINGSMYIFGGFSSVLLNDILVYKPPNCKAFRDEELCKN
AGPGIKCIWNKNHCESWESGNINNILRAKCPPKTATSDDRCYRYADCASCTANTNGCQWC
DDKKCISANSNCSMSVKNYTKCHVRNEQICNKLTSCKSCSLNLNCQWDQRQQECQALPAH
LCGEGWNHIGDACLRINSSRESYDNAKLYCYNLSGNLASLTTSKEVEFVLDEIQKYTQQK
VSPWVGLRKINISYWGWEDMSPFTNTTLQWLPGEPNDSGFCAYLERAAVAGLKANPCTSM
ADGLVCEKPVVSPNQNARPCKKPCSLRTSCSNCTSNGMECMWCSSTKRCVDSNAYIISFP
YGQCLEWQTATCSPQNCSGLRTCGQCLEQPGCGWCNDPSNTGRGHCIEGSSRGPMKLVGM
HSNEMLLDTSLCPKEKNYEWSFIQCPACQCNGHSTCINNNVCEQCKNLTTGKQCQDCMPG
YYGDPTNGGQCTACTCSGHANICHMHTGKCFCTTKGIKGDQCQLCDSENRYVGNPLRGTC
YYSLLIDYQFTFSLLQEDDRHHTAINFIANPEQSNKNLDISINASNNFNLNITWSVGSTA
GTISGEETPIVSKTNIKEYRDSFSYEKFNFRSNPNITFYVYVSNFSWPIKIQIAFSQHNT
IMDLVQFFVTFFSCFLSLLLVAAVVWKIKQTCWASRRREQLLRERQQMASRPFASVDVAL
EVGAEQTDFLRGPLEGAPKPIAIEPCAGNRAAVLTVFLCLPRGSSGAPPPGQSGLAIASA
LIDISQQKPSDSKDKTSGVRNRKHHLSTRQGTCV
Download sequence
Identical sequences F6QXI1
ENSECAP00000008096 ENSECAP00000008096 9796.ENSECAP00000008096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]