SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000008185 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000008185
Domain Number 1 Region: 828-983
Classification Level Classification E-value
Superfamily vWA-like 1.91e-17
Family Integrin A (or I) domain 0.02
Further Details:      
 
Domain Number 2 Region: 384-531
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000477
Family Integrin A (or I) domain 0.051
Further Details:      
 
Weak hits

Sequence:  9796.ENSECAP00000008185
Domain Number - Region: 47-204
Classification Level Classification E-value
Superfamily vWA-like 0.000778
Family Integrin A (or I) domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000008185
Sequence length 1052
Comment (Equus caballus)
Sequence
MRKIHFSTEIIHQFESKLSEAVELYQQRIQWLTENSKKAFGLIKGARVGILIDVSAINSS
PQTEEFQNDLVSLIDEQLSLKEKLYVLSFGTTTSALWPDPVEVKASTLQELKLWVKKLQP
DVGSNLLQALKKIFAVKELNSLVTIMGSCPDQPSEILSDYIQQSVVGRGLITHIITYKCD
HQVPPAVLRNLAEAVGGYYHCYSPETEICTSREVDELLAEIQKAQNLLGHVQALHHSTPW
DELTCMMRELSTEIAKGPLTSLLPKPPKHEAPLTIEFPNLDKTSAEWLKINGLKAKKLSL
YQVLAPNAFSPVEEFVPILQKTVSSTIHEKAMVQFEWHDGTVKNIHVDPPFLYEYQKQLS
RAMRMYERRIEWLSLASRRIWGTVCEKRVVILLDISATNSMYIIHIQHSLRLLLEEQLSN
KDHFNIIAFGSTIESWKPEMVAVSHDNLQSAWRWALTLQCRGSRNVLSALRKAVEVDFKD
KDKHQSQGIYLFTGGVPDQDMPTLRAYVAEACGGCDLQLHVCLFYVGEPQMDTTPPACYA
SRTDTAAAYRDVTRAAGGRFHWFGDTGIYESDDINAIMSEMEKALNYSQKCALLVSSLKN
QSRKELESAALPKEKSKMLKQRSQPKKLCPSKPTAPSVARMSIKGGPDREKSSSSQQAKC
PPAAAQPKREGTAERRRKTKSREAETSLLLFYTETGNNVGSVYKKYPQGRGVRRTSSSIE
LPRKDTVCSSQEWVANYGLKKLKMEISRYIGPKCSHQKSAQRSASAKYCSVFPSVEINGT
VRHIQWTPRELEAYITHLEKVMRRYVQRLQWLLSGSRRLFGTILESKVCILLDTSGSMGP
YLQQVKTELILLIWEQLRKHCDSFNLLSFAEGLQLWQDTLVETTDVACHEAMQWVTHLHA
QGSTSVLEALLATFSFPDVEGLYLLTDGKPDTSCSLILSEVQRLQENRDVKVHTISLSCS
DRAAANFLRRLASLTGGRYHCPAGEDTLVRIHGLLTKGSVDERDPTLPLFEGDDLRRLAQ
EIAKARSFLWQAQSFRSQLQKKTNTEPKVALF
Download sequence
Identical sequences F6PJ84
9796.ENSECAP00000008185 ENSECAP00000008185 ENSECAP00000008185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]