SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000008350 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000008350
Domain Number 1 Region: 166-289
Classification Level Classification E-value
Superfamily PH domain-like 8.3e-25
Family Third domain of FERM 0.0025
Further Details:      
 
Domain Number 2 Region: 102-173
Classification Level Classification E-value
Superfamily Second domain of FERM 1.18e-18
Family Second domain of FERM 0.0042
Further Details:      
 
Domain Number 3 Region: 8-102
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-17
Family First domain of FERM 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000008350
Sequence length 290
Comment (Equus caballus)
Sequence
SEMTPEHRDVLVLLPTREQLRLVVGVQATGRELFQQVCDLTSIREAHFFGLSVVRNNEYV
FMDLEQKLSKYFSKDWKRERHTVTGRSRAPFVAFLRVQYYVENGRLISDRRARHLYYCHL
KERVLRSECAHREEAYFLLAAYGLQADLGNHREAAHSGRYFEPHAYFPPWDKKGEQPTIV
LGLTLKGMHIYQEVNHALQLLYDFPWSHVGKLAFLGKKFEIRLDGLPSAKKLVYYTGCAS
RSRHLLQLLSSSHQLHLALQPLLRQLRELEEAEEKKCYRESYISDTLELE
Download sequence
Identical sequences F6QEG8
9796.ENSECAP00000008350 ENSECAP00000008350 ENSECAP00000008350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]