SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000008714 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000008714
Domain Number 1 Region: 89-150
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-23
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 2 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.32e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 3 Region: 435-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.81e-22
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 376-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.9e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 5 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.81e-20
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 6 Region: 474-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.11e-17
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000008714
Sequence length 530
Comment (Equus caballus)
Sequence
RMQIRPGMGERETPSVPEDQPALWESPWTSGYTELKAAVQIQRAAMPVPALGLPNWWGAG
GSALPAQDPMRHQEASAEEAAMTPGVLTACPQELVTFADVAVLFTPEEWLFLDSAQRSLY
RDVMLENYRNLASVGDQLCTPSTFVHLEQREEPWTTERGLCPGARPESQLQPQDSLANHD
ISVEIPSIGAQRARAVAGEQLHKHAELGAPLPVEPLCPSQRIPAGGDPCGCRGRGEAFLQ
MGLMAPEKAGGGDKALACGQCAKSFRYSSDLARHARTHSAERGFACRECGRAFKCPSNLR
RHARAHTGEKPFACAQCGKAFTRNFNLLLHRRSHTGEKPYACPACGKTFNQPSSLRSHAR
THTGEKPFACAHCGKAFREPSSLKTHLRTHTREKPYACEQCGKPFRTSTHLSVHRRVHTG
EKPYGCATCGQVLSRLSTLRSHMRTHTGEKPYACQQCGRAFSEPSSLRKHVRTHTGHKPY
ACQQCGRAFGQSSHLTVHGRTHTTGRPYACTQCEKAFRHSSSLAVHRRAH
Download sequence
Identical sequences F7DQV1
9796.ENSECAP00000008714 ENSECAP00000008714 ENSECAP00000008714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]