SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000008992 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000008992
Domain Number 1 Region: 1-166
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.35e-61
Family T-box 0.00000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000008992
Sequence length 167
Comment (Equus caballus)
Sequence
RRMFPFLSFNISGLDPTAHYNIFVDVILADPNHWRFQGGKWVPCGKADTNVQGNLFYMHP
DSPNTGAHWMRQEISFGKLKLTNNKGASNNNGQMVVLQSLHKYQPRLHVVEVNEDGTEDT
SQPGRVQTFTFPETQFIAVTAYQNTDITQLKIDHNPFAKGFRDNYDT
Download sequence
Identical sequences F7BWJ4
9796.ENSECAP00000008992 ENSECAP00000008992 ENSECAP00000008992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]