SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000010019 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000010019
Domain Number 1 Region: 5-175
Classification Level Classification E-value
Superfamily E set domains 8.05e-75
Family Arrestin/Vps26-like 0.00000032
Further Details:      
 
Domain Number 2 Region: 177-372
Classification Level Classification E-value
Superfamily E set domains 3.85e-55
Family Arrestin/Vps26-like 0.00000154
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000010019
Sequence length 393
Comment (Equus caballus)
Sequence
MANTSKVFKKTCSNGKLSIYLGKRDFVDHVDTVEPIDGVVLVDPDYLKGRKMFVMLTCAF
RYGHDDLDVIGLTFRKDLYVQVQQVVPPEPSSPQGPLTVLQERLLHKLGENAYPFTLQMA
VNLPCSVTLQPDPEDTGKACGIDFEVKSFCAENLEEKISKRDSVRLVIRKIQFAPLEPGP
GPSAQTVRRFLLSAQPLQLQAWMDREVHYHGKPISVNVSINNCTNKVIKKIKISVDQTTD
VVLYSLDKYTKTVFTQEFTETIAANSSFSKSFAVTPLLDAKCQKQGLALDGKLKHGDTNL
ASSTILRPGMDKELLGILVSYKVRVNLMVSCGGILGDLTASDVGVELPLILMHPKPSQEA
ASSEDIVIEEFTRQEPGEEESQEALAAEGDEGS
Download sequence
Identical sequences F6QH79
ENSECAP00000010019 XP_008505509.1.77740 9796.ENSECAP00000010019 ENSECAP00000010019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]