SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000010126 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000010126
Domain Number 1 Region: 66-150
Classification Level Classification E-value
Superfamily E set domains 0.00000000175
Family Filamin repeat (rod domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000010126
Sequence length 515
Comment (Equus caballus)
Sequence
SFQLWTTLKLPISLHHWNYFTNSLCPDASLNPVVSLAETELRIKKIMEELDQLVPPRPFT
HMNTTTSAAHSRATLLNPQDTYCKGDQLDILLQVRDHLGRRKEYGGDFLRARMSSPALQA
GASGKVTDFNNGTYLVSFTLFWEGQVSLSLLLIHPSEGVSALWRARNQGYDKVIFTGQFA
SGTSHVNTDCALLLNSSAELCQYLDAQDQEAFYCVKPPQAPCAALTHMYSKNKEVSYLSE
QERSLFERSNVGVEIMENFDAISVSQCNKKRVPTKKKCKFGMTSTIPSGHVWKDTWNPVS
CSLAPIKMKECLRGKFIHLMGDSTIRQWMEYFKSSINTLKSVDLHELGKFQNLLAVDLDK
NINIQWQKHGYPLIGSLIYSVKDIEYLARVIDRTGGEKNTIIVISLGQHFRPFPIDVFIR
RALNVHKAVQRLLLRSPDTMVIIKAENIRDMDADMERFSDFHGYIQYLVIKDIFQDLNVG
IIDAWDMTIAYGTNNVHPPQSVVRNQINILLNYIC
Download sequence
Identical sequences F6REV5
ENSECAP00000010126 9796.ENSECAP00000010126 ENSECAP00000010126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]