SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000011289 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000011289
Domain Number 1 Region: 110-264
Classification Level Classification E-value
Superfamily E set domains 1.75e-18
Family Arrestin/Vps26-like 0.069
Further Details:      
 
Domain Number 2 Region: 40-110
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000147
Family Arrestin/Vps26-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000011289
Sequence length 318
Comment (Equus caballus)
Sequence
FAAIRVTCTGSCRVSTKANDASWVVEEGYSNSALSLADKGDLPAGEHNFPFQFLLPAAAP
TSFEGPFGKIVYQVRATIDTPRFSKDHQCSRVFYILSPLNLNSIPDIEQPNVASTTKKFS
YKLVKTGTVVLTASTDLRGYVVGQVLRLQADIENQSGKDTSPVVASLLQKVSYKAKRWIY
DVRTIAEVEGAGVKAWRRAQWQEQILVPALPQSALPGCSLIHVDYFLQVSLKVPEATVTL
PVFIGNIPVNHAPLSPQPGPSPPPGALSRVVPSAPPQEEDEAMASGPHLEDPISLFTKSH
SQQQPPQAAFGSVPGAPE
Download sequence
Identical sequences F7AFH1
9796.ENSECAP00000011289 ENSECAP00000011289 ENSECAP00000011289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]