SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000011458 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000011458
Domain Number 1 Region: 289-409
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000298
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 116-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000287
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 160-282
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000204
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 4 Region: 83-125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000024
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  9796.ENSECAP00000011458
Domain Number - Region: 772-899
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000526
Family Growth factor receptor domain 0.0054
Further Details:      
 
Domain Number - Region: 996-1045
Classification Level Classification E-value
Superfamily EGF/Laminin 0.013
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 524-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0502
Family Laminin-type module 0.022
Further Details:      
 
Domain Number - Region: 1175-1201
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0542
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 1431-1459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0887
Family EGF-type module 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000011458
Sequence length 1460
Comment (Equus caballus)
Sequence
PHVCAEQELTLVGRRQPCVRAFSQTVPVWKPGCGRQVWCVGHERRTVYYTSYRQVYTMET
QTVFRCCPGWSQQPGDRGCLSPKCSAGLCFNGGRCVPGSAQLCHCPQGFQGPRCQYDVDE
CQVHNGGCQHRCVNTPGSYLCECRPGFRLHADGRTCLVINSCAVGNGGCQHDCVQLTVTQ
HRCQCRPTFQLQEDGRRCVRRNPCTDRNGGCMHTCQALRGLAHCECHAGYRLAADRKACE
DVDECAMGLAQCAHSCLNTHGSFKCVCHAGYELGADGRQCYRIEMEIVNSCEADNGGCSH
GCSHSSTGPLCTCPRGYELGEDQKTCIDVDDCADSPCCQQVCTNSPGGYECGCYAGYRLS
TDGCGCEDVDECASGRGSCEHHCTNLAGSFQCSCEAGYRLDEDRRGCTPLEMPELDLDSQ
LPLVRHLPHIAVLRDELPHRFQDDYVGAEEEEAEARGEHTLAEKFVCLDDAFGQDCSLTC
DDCRNGGTCLPGLPGCDCPEGWTGLVCNETCPPDTFGKNCSFSCNCQNGGTCDPMTGACR
CPPGVSGAHCEDGCPKGFYGKHCRKKCHCANRGRCHRLYGACLCDPGLYGRFCHLTCPPW
AFGPGCSEECRCEQRNTRACDRRDGSCSCKAGFRERCEDECEPGSFGLGCRQTCACPLGA
ACDPVSGECGKQCPAGYRGKDCDQECPGGTFGVNCSGSCSCWGASCDRVTGQCLCPPGRT
GDDCGADCPEGRWGLGCQEICPACEHGATCEPETGACLCRPGYMGSRCQDACPAGWFGPG
CQMRCSCANDGHCHPATGHCSCAPGWTGLSCQRACDSGHWGPDCSHTCNCSTGHGSCDAA
SGLCLCEAGYLGPQCEQQCPQGYFGPGCGQRCQCEHGAACDHVSGACTCPAGWRGTFCER
ACPAGFFGVDCRSACNCTAAAPCDAVSGSCLCPGRRGPRCAQTCPAHTYGHNCSQVCSCF
NGASCDPVQGQCRCGPGWSGPTCLQACPAGLYGEDCQHSCLCQNGGTCDPVSGHCTCPEG
WAGLACEKECLPGHFGADCQHSCRCVNGGLCDRCLGHCICPAGWTGDKCQSSCPQGWFGE
ACAQRCHCPPGAACHHISGECRCPPGFTGPGCEQACPPGTFGESCGQKCQCPGKNQACHP
ASGACVWAAGFHGTGCGLRCPPGRFGPGCEQLCGCVNGGSCDAATGACRCPAGFLGPDCS
LACPQGRFGPSCAHVCKCGQGAACNPVTGTCTCPAGRTGIHCEHSCPQNRFGLGCEHVCS
CRNGGLCHPANGSCSCGLGWMGTLCELACPAGRYGAACRLECSCRNNGTCEPATGACRCR
PGFYGQACEHLCPPGFHGAGCQGACECQQGAPCHPVSGQCLCPAGFHGQFCERGCEPGSF
GEGCHQQCDCESGVPCDPITGHCLCPPGRMGATCDLDCRGGLFGPGCALRCDCGGGADCD
PITGQCHCVDGYTGPTCRQG
Download sequence
Identical sequences F7BC54
ENSECAP00000011458 ENSECAP00000011458 9796.ENSECAP00000011458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]