SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000011482 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000011482
Domain Number 1 Region: 437-535
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.54e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000188
Further Details:      
 
Domain Number 2 Region: 579-651
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.26e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 1050-1125
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.63e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000082
Further Details:      
 
Domain Number 4 Region: 646-722
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.94e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000083
Further Details:      
 
Domain Number 5 Region: 345-432
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000432
Further Details:      
 
Domain Number 6 Region: 972-1048
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.8e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000909
Further Details:      
 
Domain Number 7 Region: 146-218
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.84e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000134
Further Details:      
 
Domain Number 8 Region: 727-831
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.76e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Domain Number 9 Region: 1120-1197
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.26e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000649
Further Details:      
 
Domain Number 10 Region: 866-918,948-971
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 11 Region: 290-364
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000818
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 12 Region: 218-295
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Weak hits

Sequence:  9796.ENSECAP00000011482
Domain Number - Region: 100-148
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0517
Family Eukaryotic type KH-domain (KH-domain type I) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000011482
Sequence length 1268
Comment (Equus caballus)
Sequence
MSSVAVLTQESFAEHRSGLVPQQIKVATLNSEEESDPPTYKDAFPPLPEKAACLENAQEP
AGAWSNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKICLEIMQRTGAHLELSLA
KDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKT
ATKIQIPRPDDASNQIRITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGP
YNRLVGEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAV
EVKKSQHKYVIGPKGNSLQEILERTGVSVEIPPSDSISETVILRGEPEKLGQALTEVYAK
ANSFTVSSVSAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDRITLEGPTEDVNVA
QEQIEAMVKDLINRMDYVEINIDHKFHRHLIGKSGANINRIKDQYKVSVRIPPDSEKSNL
IRIEGDPQGVQQAKRELLELASRMENERTKDLIIEQRFHRTIIGQKGERIREIRDKFPEV
IINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKG
GANIKKIREESNTKIDLPAENSNSETIIITGKRANCEAARSRILSIQKDLANIAEVEVSI
PAKLHNSLIGTKGRLIRSIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKKQLLHLA
EEKQTKSFTVDIRAKPEYHKFLIGKGGGKIRKVRDNTGARIIFPAAEDKDQELITIIGKE
DAVREAQKELEALIQNLDNVVEDSMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRS
GTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTIECAIPQKFHRSVMGPKGSRIQQIT
RDYNVQIKFPDREENPVHSVEPAVQENGDDAGEGRDAKEADPGSPRRCDIITISGRKEKC
EAAKEALEALVPVTIEVEVPFDLHRYIIGQRGSGIRKMMDEFEVNIHVPAPELQSDIIAI
TGLAANLDRAKAGLLERVKELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRL
EHDVNIQFPDKDDGNQPQDQITITGYEKNTEAARDAILKIVGELEQMVSEDVPLDHRVHA
RIIGARGKAIRKVMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLAD
VVDSEALQVYMKPPAHEESKAPSKGFVVRDAPWTANSSEKAPDMSSSEEFPSFGAQVAPK
TLPWGPKR
Download sequence
Identical sequences F7BB45
XP_001503035.1.31192 XP_008525418.1.77740 XP_014698381.1.49734 XP_014698382.1.49734 9796.ENSECAP00000011482 ENSECAP00000011482 ENSECAP00000011482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]