SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000012223 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000012223
Domain Number 1 Region: 138-550
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3e-87
Family Amylase, catalytic domain 0.00011
Further Details:      
 
Domain Number 2 Region: 552-650
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.94e-23
Family alpha-Amylases, C-terminal beta-sheet domain 0.014
Further Details:      
 
Domain Number 3 Region: 22-134
Classification Level Classification E-value
Superfamily E set domains 2e-18
Family E-set domains of sugar-utilizing enzymes 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000012223
Sequence length 654
Comment (Equus caballus)
Sequence
RYNRFSQTLDNIGKNEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNDW
NPFSYPYKKLDYGKWDLYIPPKPNKSLLVPHGSKLKVVIRSKSGEILYRISPWAKYVVRE
SGNVNYDWIHWDPEQPYKFKHSRPKKPRSLRIYESHVGISSHEGKIASYKHFTCNVLPRI
KGLGYNCIQMMAIMEHAYYASFGYQITSFFAASSRYGTPEELKELVDTAHSMGITVLLDV
VHSHASKNSEDGLNMFDGTDSCYFHSGPRGTHDLWDSRLFIYSSWEVLRFLLSNIRWWLE
EYGFDGFRFDGVTSMLYHHHGIGASFSGDYHEYFGLQVDEDALTYLMLANHLVHTLYPDS
ITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLVKEFKDEDWNMGNIVYTLTNR
RHLEKCIAYAESHDQALVGDKSLAFWLMDAMYTNMSVLTPFTPVIDRGIQLHKMIRLITH
ALGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMN
KLEERCGWLSAPQAFVSEKHEGNKVIAFERAALLFIFNFHPSKSYTNYRVGTTLPGKYPF
SLGSDAAEYGGHQRLDHNTDFFSEPYEHNERPSSLLVYIPSRVALILQNVDPPN
Download sequence
Identical sequences F7DTE4
9796.ENSECAP00000012223 ENSECAP00000012223 ENSECAP00000012223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]