SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000012257 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000012257
Domain Number 1 Region: 160-338
Classification Level Classification E-value
Superfamily vWA-like 1.36e-25
Family Integrin A (or I) domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000012257
Sequence length 998
Comment (Equus caballus)
Sequence
MEEMFHKKSEAVRRLVEAAEEAHLKHEFDADLQYEYFNAVLINERDKDGNFLELGKEFIL
APNDHFNNLPVNISLSDVQVPTNMYNKDPAIVNGVYWSESLNKVFVDNFDRDPSLIWQYF
GSAKGFFRQYPGIKWEPDENGVIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTI
AKQTVSSILDTLGDDDFFNIIAYNEELHYVEPCLNGTLVQADRTNKEHFREHLDKLFAKG
IGMLDIALNEAFNILSDFNHTGQGSICIQAIMLITDGAVDTYDTIFAKYNWPDRKVRIFT
YLIGREAAFADNLKWMACANKGFFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTE
AYIDSTLPQAQKLADDQGLVLMTTVAMPVFSKQNETRSKGILLGVVGTDVPVKELLKTIP
KYKLGIHGYAFAITNNGYILTHPELRPLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNA
MVNRKTGKFSMEVKKTVDKGKRVLVMTNDYYYTDIKGTPFSLGVALSRGHGKYFFRGNVT
IEEGLHDLEHPDVSLADEWSYCNTDLHPEHRHLSQLEAIKLYLKGKEPLLQCDKELIQEV
LFDAVVSAPIEAYWTSLALNKSENSDKGVEVAFLGTRTGLSRINLFVGAEQLTNQDFLKA
GDKENIFNADHFPLWYRRAAEQIPGSFVYSIPFSTGTVNKSNVVTASTSIQLLDERKSPV
VAAVGIQMKLEFFQRKFWTASRQCASLDGKCSISCDDETVNCYLIDNNGFILVSEDYTQT
GDFFGEVEGAVMNKLLTMGSFKRITLYDYQAMCRANKESSDGAYGLLDPYNAFLAAVKWI
MTELVLFLVEFNLCSWWHSDITAKAQKLKQTLEPCDTEYPAFVSERTIKETSGNIACEDC
SKSFVIQQIPSSNLFMVVVDSSCLCESIAPITMAPIEISQHNESLKCERLKAQKIRRRPE
SCHGFHPEENARECGGAPGIQAKMVLILFPLLLMLFSR
Download sequence
Identical sequences F7DP03
ENSECAP00000012257 9796.ENSECAP00000012257 ENSECAP00000012257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]