SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000012621 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000012621
Domain Number 1 Region: 81-187
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-32
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 2-67
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000183
Family Spermadhesin, CUB domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000012621
Sequence length 529
Comment (Equus caballus)
Sequence
LDPDGSCDSENIKVFDGNSTAEALLGQVCSKNDYVPVFESSLNTLTVQIVTDAARIQRSV
FIFYYFFSPGTSIPNCGGSLDALEGSFTSPNYPKPHPELAYCVWHIQVEKGYKIKLDFTE
IFLEVDEYCRFDFVAVYDGSSTTSGLMGQVCGRVKPTFESSSDSLTIVLSTDYANSYRGF
SASYTSIYTENVDTTSLTCSSDKMRVIINKSYLESLKYNENNLQLNDPTCRPKVSNVVEF
SILLDECGTIKKVEDHSITYTNVITFTASQASEVITRQKRLQIVVKCEMENNSTVEIMYI
TEDDIIQNQNALGRYNTSMAFFESNSFEKPILASPYYVDLNQTVFVQVSLYTSDANLVVF
LDSCITSPTSDFASPNYDLIKKGCIQDETCDVYPLSRHHARFQFNAFKFLRSLSSVYLQC
EVLICDSSDHQSRCHQGCVSRRKRDISSYKWKANSIIGPIRLKRDRSTSGNSGLQYQIHG
GETQNQPFNSLYLFSFMVLALNVVIVATVIARHFVNQRTDYKYQKLQNN
Download sequence
Identical sequences F7D2L3
ENSECAP00000012621 ENSECAP00000012621 9796.ENSECAP00000012621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]