SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000012976 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000012976
Domain Number 1 Region: 2182-2286
Classification Level Classification E-value
Superfamily C-type lectin-like 2.83e-30
Family Link domain 0.00022
Further Details:      
 
Domain Number 2 Region: 1569-1719
Classification Level Classification E-value
Superfamily FAS1 domain 5.76e-29
Family FAS1 domain 0.0013
Further Details:      
 
Domain Number 3 Region: 973-1123
Classification Level Classification E-value
Superfamily FAS1 domain 4.05e-28
Family FAS1 domain 0.0019
Further Details:      
 
Domain Number 4 Region: 1729-1875
Classification Level Classification E-value
Superfamily FAS1 domain 3.79e-25
Family FAS1 domain 0.0035
Further Details:      
 
Domain Number 5 Region: 520-650
Classification Level Classification E-value
Superfamily FAS1 domain 3.14e-24
Family FAS1 domain 0.0017
Further Details:      
 
Domain Number 6 Region: 1131-1259
Classification Level Classification E-value
Superfamily FAS1 domain 5.76e-22
Family FAS1 domain 0.0051
Further Details:      
 
Domain Number 7 Region: 333-499
Classification Level Classification E-value
Superfamily FAS1 domain 2.09e-18
Family FAS1 domain 0.004
Further Details:      
 
Domain Number 8 Region: 2280-2439
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000719
Family FAS1 domain 0.0091
Further Details:      
 
Domain Number 9 Region: 1509-1547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000496
Family Merozoite surface protein 1 (MSP-1) 0.085
Further Details:      
 
Domain Number 10 Region: 1463-1518
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family EGF-type module 0.067
Further Details:      
 
Domain Number 11 Region: 229-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000593
Family EGF-type module 0.044
Further Details:      
 
Weak hits

Sequence:  9796.ENSECAP00000012976
Domain Number - Region: 1993-2116
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000251
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number - Region: 2125-2157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00107
Family EGF-type module 0.063
Further Details:      
 
Domain Number - Region: 860-912
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0046
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 193-231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00656
Family Merozoite surface protein 1 (MSP-1) 0.032
Further Details:      
 
Domain Number - Region: 731-775
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0067
Family EGF-type module 0.0091
Further Details:      
 
Domain Number - Region: 916-947
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0073
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 1952-1995
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0201
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 825-862
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0342
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 103-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0893
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000012976
Sequence length 2541
Comment (Equus caballus)
Sequence
LILFFLGLVVQNFCSPPETTEQAKRCDKKSRLIIRTECQSCSLNFGINCPDGYTKITNGS
VGVRDCRYTFEVRTYSLSLPGCRHICRKDYLQPQCCPGHWGPDCMECPGGARSPCSGRGS
CADGMEGNGSCSCREGFGGTACETCADDNLFGPSCSAVCNCVHGVCNSGIDGDGTCECHS
AYTGPSCDQPIPECAALLCPENSRCSPSSEDGTKLECKCLPNYKGDGKYCEPINPCLQDV
CHPHARCTYLGPNQHSCTCQDGYRGDGQVCLPVDPCQINFGNCPARSTVCKYDGPGQSHC
ECKEHYRNFVPGVGCSVTDICESNNPCHRNANCTTIAPGQTRCTCRKGYVGDGSTCYGNI
MERLRELNTEPRGRWQGRLTSFISLLDKAYAWPLSNLGTFTVLLPTDKGLKGFNVKQLLM
DNEAAQYFVKLHIIAGQMNTECMNNTDTFYTLTGKSGEIFRSDKDNRLNLKLYGGKRKVK
IIEGNIVASNGLLHILDRAMDKMAPTFKSNTEKPIMTMLQPRYSKFRSLLEETNLGHALD
EDGVDGPYTIFVPSNEALNNMKDGTLDFLLSPEGSRKLLELVRYHIVPFTQLAVATLIST
PHIRSMANQIIQFNTTDNGRILANGVAMEEIEVAAKNGRIYTLTGVLIPPSIVPILHHQC
DETKREMKLGTCVSCSLVYWSKCPANSEPTALFTHKCVYTGRTRSLKSGCARYCNATVKI
PKCCKGFYGPDCNQCPGGFSNPCSGNGQCVDGIGGNGTCICQDGFQGSQCQFCSDPNKYG
PQCDKKCLCIDGVCDNRIDSDGACLPGTCRAGSTGRFCHKQTSACGPYVQFCHIHATCEY
SNGTASCVCKAGYEGDGSLCSETDPCAGSTPGGCSRNAECIKTGVGTHTCVCQQGWTGDG
RDCSEINNCLLPSAGGCHDNATCLYVGPGQNECECKKGFRGNGIDCEPITSCLEQTGKCH
PLATCQFTSGIWSCVCREGYEGDGLLCYGNVAVELSFLSAAAVFNQWLNNASLQPLLSAT
SNLTVLVPSQQAIEDMDQEEKAFWLSRSNIPALIRYHTLPGTYGLADLQALSSSDMLATS
LQGSFLHLAKADGNITIEGASIVDGDNAATNGVIHIINKVLLPQRGLTGSLPNLLTRLEQ
MPDYSIFRGYIIQYNLANAIEAADAYTVFAPNNDAIENYVREKKVTSLEEDIVKYHVVLE
EKLLKNDLHNGMHRETMLGFSYLLAFFLHDDQLYVNEAPINYTNVATDKGVIHGLGKVLE
IQKNRCDNNDTTIVPGKCGKCPQQPICPLGTKPLVKTKKCIYTVYFMGKRSVFIGCQPKC
VKTVITRECCAGFFGPQCQPCPGKAGNVCFGNGICLDGMNGTGVCECGEGFTGTACETCT
EGKYGVHCDQACSCVHGRCNQGPSGDGSCDCDVGWRGVKCDSEITKDNCNGTCHTSANCL
LNPDSQPHVSCGRIFVGSFEIRESINACEISNGGCSTKADCKRTTPGSRVCVCKEGYAGD
GIVCLEINPCLENHGGCHKNAECTQTGPNQAVCNCLPKYTGDGKICTLTNTCLTKNGGCS
EFAICSHTGSEERTCTCKPNYVGDGFTCRGNIYQELPRNPSTSQYFFQLLEHSVRDLAGP
GSFTVFAPLSAAFDDEPKIKDWDKQGVMPQVLRYHVIACHRLLLENLKLTPNATSLQGEP
LVISVSQDGVYINNKAKIISSDVIATNGIIHIVDKLLSPQNLIVTPKDASGRILQNLTTV
ARNHGYTKFSNLLQEAGLLSLITDPVHTPITLFWPTDQALQALPPEQQDFLFNQGNKDKL
EEYLKFHVIRDSKVSAVDLLRSATWKTLQGSELSVKCGAGSDIGQLFLNDQRCRIVQREL
LFDLGVAYGIDCLLIDPTLGGRCDTFATFDISGDCGSCVSPPSCPRGTKPKGMKQRCLYN
LSFKRNLEGCQQQCILVMQLPRCCKGYYGRDCQACPGGPDTPCNNRGVCLDQYSATGTCK
CNTGFNGTACELCWPGRFGPDCQPCGCSDHGECDDGVTGSGQCVCETGWTGRFCDTQTAL
APVCTPPCSAHATCKENNTCECKLNYEGDGITCTVVDFCKQNNGGCATVAKCSQKGTKVS
CSCPKGYRGDGRSCTEIDPCADGLNGGCHEHATCRMTGPGKHKCECKSHYVGTGVDCEPE
QLPIDRCLQDNGQCHADASCADLHFQDTTVGVFHLRSPLGQYKLTFNKAREACANEAATM
ATYNQLSYAQKAKYHLCSAGWLESGRVAYPTAFSSQNCGSGVVGIVDYGPRNKSETWDVF
CYRMKDVNCTCKVGYVGDGFSCSGNLLQVLMSLPSLTNFLTVCAVLERGVSERRPWLTHL
DLWPAHGTCYIALKSNDSSVKSSSIRSLRNPFSNSSLQLLDQVIGTKATNVLWSVLAVSR
SPMLPISENRFVDGRAILQWDIFASNGIIHVISRPLKAPPAPVAAVHTGLGAGIFFAVVL
AIGAIALAAYSYFRLNRRSIGFQRFESEEDISVTALGKQQPENISNPLYDSMTSAPPEPS
YDPFSDSEDQQLESSDPLGAL
Download sequence
Identical sequences F7CVR3
ENSECAP00000012976 ENSECAP00000012976 9796.ENSECAP00000012976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]