SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000013280 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000013280
Domain Number 1 Region: 482-690
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-43
Family DBL homology domain (DH-domain) 0.00036
Further Details:      
 
Domain Number 2 Region: 166-310
Classification Level Classification E-value
Superfamily PH domain-like 4.61e-42
Family Third domain of FERM 0.00024
Further Details:      
 
Domain Number 3 Region: 821-972
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-33
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 4 Region: 66-168
Classification Level Classification E-value
Superfamily Second domain of FERM 1.05e-27
Family Second domain of FERM 0.00013
Further Details:      
 
Domain Number 5 Region: 680-802
Classification Level Classification E-value
Superfamily PH domain-like 1.82e-27
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 6 Region: 2-65
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-18
Family First domain of FERM 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000013280
Sequence length 989
Comment (Equus caballus)
Sequence
QRAPGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVV
KFFPPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEASDR
EHLAKNKYIPQQDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREG
TKINLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSSYQDTLEFLMA
SRDFCKSFWKICVEHHAFFRLFEEPKPKPKAVLFSRGSSFRFSGRTQKQVLDYVKEGGHK
KVQFERKHSKIHSIRSLATQPAEPNSEVPKQAQQSASLTLGEGAESPDGQSCQQGKELNA
SSAERGPHQSPALQKSPVGNKKADGAVKAMAEEEEEVVKDRTQQSKPQPPQPSTGSLTGS
PHLSELSINSQGGAVPANVVFSPNLSPDTKQASPLVSPLLNEQACPRTDDEEEGRRKRFP
TDKAYFIAKEVSTTERTYLKDLEVITSWFQSTVSKEESMPETLKSLIFPNFEPLHKFHTN
FLKEIEQRLALWEGRSNAHIRGDHQRIGDVMLKNIQGMKQLAAHLWKHGEALEALETGIR
SSRRLENLCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPSHMDFRDCRAA
LAEITEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVIPGREFIRLGSLSKLSGKGLQQ
RMFFLFNDILLYTSRGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSIIV
AASSRSEMEKWVEDIQMAIDLAEKSSGPTPEFLASSPPDNKSPDETAVADQESEDDLSAS
RTSLERQAPHRGNTMVHVCWHRNTSVSMVDFSVAVENQLSGNLLRKFKNSNGWQKLWVVF
TNFCLFFYKSHQDNHPLASLPLLGYSLTIPSESEDVHKDYVFKLHFKSHVYYFRAESEYT
FERWMEVIRSATSSASRAHILSHKESHVY
Download sequence
Identical sequences F6V541
ENSECAP00000013280 ENSECAP00000013280 9796.ENSECAP00000013280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]