SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000014268 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000014268
Domain Number 1 Region: 921-1143
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-41
Family DBL homology domain (DH-domain) 0.0019
Further Details:      
 
Domain Number 2 Region: 1299-1500
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-32
Family Pleckstrin-homology domain (PH domain) 0.0000937
Further Details:      
 
Domain Number 3 Region: 1130-1247
Classification Level Classification E-value
Superfamily PH domain-like 2.26e-22
Family Pleckstrin-homology domain (PH domain) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000014268
Sequence length 1502
Comment (Equus caballus)
Sequence
DSPKPPLAPKPKTASPLTPVATPKFPSSPRPASFPSPNSMSRGPKPPIAPKPRLAAPNDV
YVINSLNKCSNGKLLCVDRGLYEERRSSLECSESEVDEDYIVVPGAPPSEGEPRDGDSVE
NAVMAPPDVTGEEACQEGDEECDTEGTGAAEDLATPAEVVLSGEGNEGIAPSPENMEAQD
CGQDAGAEEQKFPSEEEEKLVEEHSLFKLEDKGAWDGEAVFPSDTILTHVNLEDPAAPDE
EPGPPGTLREAEEDAEEGCASADPGEPDEPAEGDTEDAGKDPPESEGLATGTQEVEMATD
SPDVSEEECEEATGGGDQNDQDGPPDQNEKNDQEEMAAVTQVAGEDPQESEDPAQDEPAE
ESCQIIPFESDCVDNFVTALSGSPYEFFPTESTSFSSESCSPFSESAKGLEPQSGACVEQ
DPVAGTPCGPCGSPQGGAGEDPSVPDVVVMPEDEDAADDALTNPYEMGVDLACEADPGEG
EQPETQAASDALLGGYGMKEEMDPDAEGGLVPMDRMNIVTRARPHSGKVAGYVPETVLEE
TGPEPGSSAIGMGGATKEMRKTVLSLEGKPLEASRALPAKPRAFTLYPRSFSVEGREIPV
SIYREPEASGLDDHRIKRKDDNLSLPCVIGSSGSFSQRNHLPSSGTSTPSSVVDIPPPFD
LACITKKPITKSSPSLLIESEPPDKHTKKKKSSFKRFLALTFKKKSESKVHVDVSVSSRS
SSESSHHGPSRLLELDRGSLSNSPQLKARTGKLRASESPSSLIFYRDGKRKGVPFSRTVS
RVESFEDRSRPPFLPLPLTKPRSISFPNADTSDYENIPAMNSDYENIQIPPRRPARAGTF
TKLFEDQSRALSTANENDGYVDMSSFNAFESKQQSADPEAESAYTEPYKVCPISTAAPKE
DLTSDAEQGSSEEEDSAPRDPSLTHKVEGQSRAHVIAQELLSSEKAYVEMLQHLHVDFHE
AVLRALDEMDQEGQDVSAREELRRSLSELPAIHDLHQGILEELEERLLNWEGQQKVADVF
LAREEGFDHHATHILQFDRSLSLLSEHCLHSPQLAAAVREFERSLQGGGQHVKHRLLRVV
QRLFQYQVLLTDYLNNLCPDSPEYDNTQGALTLISKVTDRANDSMEQGENLQKLVHIEHS
VRGQGDLLQPGREFLKEGTLMKVTGKNRRPRHLFLMSDVLLYTYPQKDGKYRLKNTLAVA
NMKVSRPVMEKVPYALKIETAESCLILSASSCAERDEWHGCLSRALPEDYKAQALAAFHH
SVEMRERLGVSLGERPPTLVPVTHVMMCMNCGCDFSLTLRRHHCHACGKIVCRNCSRNKY
PLKYLKDRMAKVCDGCYGELKKRGGDVPGLMRERPVSMSFPLSSPRFSSSAFSAVFHSIS
PSTFKKQKKAPSALTEVAASGEGSAISGYLSRCKKGKRHWKKLWFVIKGKVLYTYMASED
TVAMESMPLLGFTIAPEKEEGSSEVGPVFHLYHKKTLFYSFKAEDTSSAQRWIEAMEDAS
VL
Download sequence
Identical sequences F6X0H0
ENSECAP00000014268 9796.ENSECAP00000014268 ENSECAP00000014268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]