SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000014741 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000014741
Domain Number 1 Region: 228-374
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-38
Family Third domain of FERM 0.00062
Further Details:      
 
Domain Number 2 Region: 126-230
Classification Level Classification E-value
Superfamily Second domain of FERM 1.28e-34
Family Second domain of FERM 0.0000711
Further Details:      
 
Domain Number 3 Region: 40-123
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.93e-24
Family First domain of FERM 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000014741
Sequence length 732
Comment (Equus caballus)
Sequence
MLSFLRRTLGRRSMRKHAEKERLREAQRAATHIPAAGDSKSIITCRVSLLDGTDVSVDLP
KKAKGQELFDQIMYHLDLIESDYFGLRFMDSAQVAHWLDGTKSIKKQVKIGSPYCLHLRV
KFYSSEPNNLREELTRYLFVLQLKQDILSGKLECPFDTAVQLAAYNLQAELGDCDLAEHG
PDLVSEFRFVPVQTEEMELAVFEKWKECRSQTPAQAETNYLNKAKWLEMYGVDMHVVKAR
DGNDYSLGLTPTGVLVFEGETKIGLFFWPKITRLDFKKNKLTLVVVEDDDQGKEQEHTFV
FRLDHPKACKHLWKCAVEHHAFFRLRGPVQKGSHRSGFIRLGSRFRYSGKTEYQTTKTNK
ARRSTSFERRPSKRYSRRTLQMKASTAKPEELSVHNSVSTQSNGSQQPWGVRSALPVNPS
IPSGPVLVEVENLPRSPGTDQRDRKCLALNIDLLDSPDLLETTIDDVIGAPDPMETSQAP
DDINIAAGQTGLEEPEVECGTLKDASEKLKHLEMENSPLLSSRPNIDVNINNQEEVVKLT
EKYLNNAIESPGLNVRRLPPDLKSNILKAQVEAVHKVTREGSLLSHKNAKGQDAATNSAV
FNESNVPLLEDSLALMHTTPAENGSVLKDATDELDALLLSLTENLIDHTVTPQVSSASMI
IPRWIVPQSTVLPDGLVGKGPSLAGKEGRGDREVVSLVSPPAPFLVDAVTSPAPTLAEEA
VLKQKCLLTTEL
Download sequence
Identical sequences F6WXC9
9796.ENSECAP00000014741 ENSECAP00000014741 XP_001492516.1.31192 ENSECAP00000014741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]