SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000015107 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000015107
Domain Number 1 Region: 59-568
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 5.77e-197
Family Myeloperoxidase-like 0.0000000000000116
Further Details:      
 
Domain Number 2 Region: 19-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000233
Family EGF-type module 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000015107
Sequence length 604
Comment (Equus caballus)
Sequence
MLARALLLCVALALGHAANPCCSNPCQNRGVCMSVGFDQYQCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNSFPFLRNAVMKYVLVSRSHLIESPPTYNAQY
GYKSWESFSNLSYYTRALPPVADGCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDPKRGPAFTKGLGHGVDLSHIYGETLDRQHKLRLFKDGKMKY
QIINGEVYPPTVKDTQVEMIYPPHIPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIDDQEYNFQQFLYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAAQKIAKASIDQSREMKYQSLNEYRKRFRLTPYKSFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLLGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTAFSVQDPQLSKAVTINASASHSGLDDVNPTVLLKER
STEL
Download sequence
Identical sequences O19183
ENSECAP00000015107 NP_001075244.1.31192 XP_008512298.1.77740 XP_014721276.1.49734 ENSECAP00000015107 9796.ENSECAP00000015107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]