SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000016104 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000016104
Domain Number 1 Region: 274-422
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.95e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 2 Region: 381-517
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000157
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 163-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000493
Family EGF-type module 0.02
Further Details:      
 
Domain Number 4 Region: 197-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000395
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 5 Region: 504-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000548
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000016104
Sequence length 684
Comment (Equus caballus)
Sequence
LPCTAGADVPLEACCADGHRMATQHRDCSLPYASESKECRMVQEQCCHNQLEELHCATGI
NLANEQDGCTTPYGDNASLEAMFVKRCCHCCLLGRAAQAQGQSCEYNLMVGYQCGLVFRA
CCVKGQETADFAPGDVGDLQETAKISEVKEEQEDPYLNDRCRGGGPCKQQCRDTGEEVVC
SCFVGYQLLPDGVSCEDINECITGSHNCRLGENCINTVGSFRCQRESSCGTGYELTENND
CKDIDECESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPC
PVGQTCINTEGSYTCQKNVPNCGRGYHLNDEGTRCVDVDECSPPAEPCGPGHRCVNSPGS
FRCECKAGYYFDGISRTCIDINECRRYPGRLCGHKCENTPGSYFCSCTVGFRLLADGRSC
EDMNECNSSPCSQECANVYGSYQCYCRRGYQLSDVDGVTCEDIDECALPTGGHICSYRCI
NFPGSFQCSCPSSGYRLAPNGRNCQDIDECVTGIHNCSVNETCFNIQGGFRCLAFECPEN
YRRSADTLRQEKTDTVRCIKSCRPNDVTCVLDPVHTISHTVVSLPTFREFTRPEEIIFLR
AITPAYPANHADIIFDITEGNLRDSFDIIKRYMDGMTVGVVRQVRPIVGPFHAVLKLEMN
YVVGGVVSHRNVVNVHIFVSEYWF
Download sequence
Identical sequences F7ABC9
9796.ENSECAP00000016104 ENSECAP00000016104 ENSECAP00000016104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]