SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000016520 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000016520
Domain Number 1 Region: 1044-1138
Classification Level Classification E-value
Superfamily Immunoglobulin 4.44e-23
Family I set domains 0.0035
Further Details:      
 
Domain Number 2 Region: 756-849
Classification Level Classification E-value
Superfamily Immunoglobulin 5.16e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 852-946
Classification Level Classification E-value
Superfamily Immunoglobulin 4.54e-22
Family I set domains 0.0045
Further Details:      
 
Domain Number 4 Region: 309-403
Classification Level Classification E-value
Superfamily Immunoglobulin 2.18e-19
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 118-212
Classification Level Classification E-value
Superfamily Immunoglobulin 6.59e-19
Family I set domains 0.01
Further Details:      
 
Domain Number 6 Region: 1140-1227
Classification Level Classification E-value
Superfamily Immunoglobulin 8.41e-19
Family I set domains 0.0054
Further Details:      
 
Domain Number 7 Region: 948-1042
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-18
Family I set domains 0.0025
Further Details:      
 
Domain Number 8 Region: 663-753
Classification Level Classification E-value
Superfamily Immunoglobulin 2.88e-16
Family I set domains 0.0072
Further Details:      
 
Domain Number 9 Region: 213-307
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000584
Family I set domains 0.0071
Further Details:      
 
Domain Number 10 Region: 25-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000133
Family I set domains 0.0064
Further Details:      
 
Domain Number 11 Region: 569-660
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000024
Family I set domains 0.0041
Further Details:      
 
Domain Number 12 Region: 404-485
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000044
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000016520
Sequence length 1316
Comment (Equus caballus)
Sequence
MLWKFTLLLFCIRLSLGMTSVAIQSQPELWIETNYPQAPWENITLWCKSPSRISSKFLLL
KDKTQMTWIRPSYKTFQVSFPIGALTESNTGLYRCCYWKETGWSEPSKVLELKAPGQLPK
PIFWIQAETSPLPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGTVAIFSIANMTP
ESEGVYICRTHIQMLPTLWSEPSNPLKLIVAGLYPKPTLTAYPGPIMAPGESLNLRCQGP
IYGMTFALIRLEDLEKSFYRKRPIKNEAHFFFRALKIHDAGHYLCFYYDGSNRGSLLSDV
LKIWVTDTFPKTWLLAQPSPVVQMGQNVSLWCQGPVDGVGLALYKKGEDKPLQLLDTTSI
DDNESFFLNNVTYSDAGIYSCHYLLSWKTSIRVTSHNTVELVVVSWPSTMCKPGKAITLQ
CRVPYTVLEFSLEWEERATFQKFSVDGDFTISNVEGKGTGTYSCSYRREAHANIWSHRSE
PLKLMGPAGFLIWNYVLNEAIRLSLIIQLVALLLVVLWIRWKCRRLRIREAWLLGTAQGV
TMLFIVTALLCCGLCNGVLTEETEIIMPTPKPELWAETNFPLAPWKNLTLWCRSPSSSTK
EFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHIGSYHCHSWEEMAVSEPSEALELVGT
DILPKPVISASPPIRGQELQIWCKGWLAGMGFALYKDGVQEPVQQLGAVGREAFFTIQRM
EDKDEGNYSCRTHTEKHPFKWSEPSEPLELVIKEMYPKPFFKTWASPVVTPGARVTFNCS
TPHQRVSFILYKDGSEIASSDKSWANPGASAAHFLIISVGIGDGGNYSCRYYDFAFWSEP
SDPVELVVTEFYPKPTLLAQPGPVVLPGKNVTLRCQGAFQGMRFALLQEGTLVPLQFQST
PGNSAEFLLHTVGAEDSGNYSCVYYETTMSNRGSHLSKSIMIWVTDTFPKPWLFAEPSSV
VPMGQNVTLWCQGPVHGVGYILHKEREATSMQLWGSTSNDGAFPITNISGASIGRYSCCY
HPDWTSPIKIQPSNTLELIVTGLLPKPSLLAQPGPMVAPGENMTLQCQGELPDSTFVLLK
EGTQEPLEQQRPSGYRADFRMPAVRGEDSGIYSCIYYLDSAPFAASNHSDSLKIWVTDKP
PKPSLSAWPSTMFKLGKDITLQCRGPLPGVEFVLEHDGEEAPQQFSEDGDFVINNVEGKG
IGNYSCSYRLQAYPDIWSEPSDLLELVGAAGPAAQECTVGNIVRSSLIVVVVVALGVVLA
IEWKKWPRLRTRDSETDGRDQTIALEECNQEGEPGTSTNSPSSISQGTSVELPVPI
Download sequence
Identical sequences F6ZEK7
ENSECAP00000016520 9796.ENSECAP00000016520 ENSECAP00000016520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]