SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000016644 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000016644
Domain Number 1 Region: 251-409
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.23e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000201
Further Details:      
 
Domain Number 2 Region: 89-250
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-50
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000648
Further Details:      
 
Domain Number 3 Region: 46-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 5-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000102
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000016644
Sequence length 409
Comment (Equus caballus)
Sequence
AIAGDFCDSSQCLNGGTCLLGQDDLPFYCLCPEGFTGLICNETEKGPCFPNPCQNDGECH
VIDDSHRGDVFTQYICSCPRGYTGTHCETTCAMPLGMETGAIADAQISASSVYFGFMGLQ
RWVPELARLHRTGIVNAWTASNYDKNPWIQVNLMRKMRVTGVVTQGASRGGTAEYLKTFK
VAYSVDGRKFQFIRDAGDSKDKVFVGNVDNSGLKVNMFDVPLEVQYVRLVPVACHHGCTL
RFELLGCEVNGCAEPLGLEDNSIPDRQITASSTYRTWGLNAFSWYPFYARLDKQGKFNAW
TAQSNSASEWLQVDLGSQKQVTGVITQGARDFGHIQYVAAYKVSHSNDGANWTEYRDQRA
ADSKIFPGNLDNNSHKKNMFETPFLARFVRILPVAWHNRITLRVELLGC
Download sequence
Identical sequences F7B0S3
ENSECAP00000016644 ENSECAP00000016644 9796.ENSECAP00000016644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]