SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000016738 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000016738
Domain Number 1 Region: 332-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-20
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 3 Region: 276-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 4 Region: 431-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-18
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 
Domain Number 5 Region: 387-442
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-18
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 6 Region: 233-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-17
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 116-174
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000633
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  9796.ENSECAP00000016738
Domain Number - Region: 185-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0283
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000016738
Sequence length 488
Comment (Equus caballus)
Sequence
GCVISEDVFVYFSWEEWMLLDDAQRLLYWDVMLENFALLASLGIASFRSHLVTQLEQGEE
PWMPDQVDVTPASEREAQKGPGPGYWCGVEKEDASFKQRVSLEGVSWVKTPLAVLKTHLC
DMTGPILKDILHLTEYQRREAREKPHTCGTCGKQFWFSAILHQHQKQHSGEKPFRRDEGR
DPVKNCRISVSEKPYTYVEGRMDFPATSGLLQHQVPHIRMKPHESTELGGALHTGQRHHK
CSECGKVFTRKDTLTRHQRIHTGERPYECSKCGKFFSQSCDLFKHHTVHTGERPYECNEC
GKFFRQISGLIEHRRVHTGERLYQCSNCGKFFSSKSNLIRHQEVHTGARPYLCSECGKEF
NRKHTLVLHQRTHTGEKPYECSECGKAFSQSSHLNVHWRIHSSDYECSRCGKAFSCISKL
IQHQKVHSGEKPYECSKCGKAFTQRPNLIRHWKMHTGEQPYVCSECGKEFSRKHALVLHQ
KIHSGEKS
Download sequence
Identical sequences F7A8M0
ENSECAP00000016738 ENSECAP00000016738 9796.ENSECAP00000016738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]