SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000018230 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000018230
Domain Number 1 Region: 576-664
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-18
Family Third domain of FERM 0.005
Further Details:      
 
Domain Number 2 Region: 383-476
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-17
Family Pleckstrin-homology domain (PH domain) 0.0055
Further Details:      
 
Domain Number 3 Region: 273-324
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000798
Family Second domain of FERM 0.011
Further Details:      
 
Domain Number 4 Region: 542-575
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000497
Family Second domain of FERM 0.0041
Further Details:      
 
Weak hits

Sequence:  9796.ENSECAP00000018230
Domain Number - Region: 17-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.016
Family Ubiquitin-related 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000018230
Sequence length 687
Comment (Equus caballus)
Sequence
MALDGIRMPDGCYADGTWELSVHVTDLSRDVTLRVTGEVHIGGVMLKLVEKLDVKKDWSD
HALWWEKKRTWLLKTHWTLDKYGIQADAKLQFTPQHKLLRLQLPNMKYVKVKVNFSDRVF
KAVSDICKTFNIRHPEELSLLKKPRDPTKKKKKKLDDQSEDEALELEGPLITPGSGSIYS
SPGLYSKTMTPTYDAHDGSPLSPTSAWFGDSALSEGNPGILAVSQPITSPEILAKMFKPQ
ALLDKAKINQGWLDSSRSLMEQDVKENEALLLRFKYYSFFDLNPKYDAIRINQLYEQAKW
AILLEEIECTEEEMMMFAALQYHINKLSIMTSENHLNNSDKEVDEVDAALSDLEITLEGG
KTSTILGDITSIPELADYIKVFKPKKLTLKGYKQYWCTFKDTSISCYKSKEESSGTPAHQ
MNLRGCEVTPDVNISGQKFNIKLLIPVADGMNEIWLRCDNEKQYAHWMAACRLASKGKTM
ADSSYNPEVQNILSFLKMQHLNPDPQFIPEQITADINPECLVSPRYLKKYKNKQPGYIRD
LITARILEAHQNVAQMSLIEAKMRFIQAWQSLPEFGITHFIARFQGGKKEELIGIAYNRL
IRMDAGTGDAIKTWRFSNMKQWNVNWEIKMVTVEFADEVRLSFICTEVDCKVVHEFIGGY
IFLSTRAKDQNESLDEEMFYKLTSGWV
Download sequence
Identical sequences F6TBY6
ENSECAP00000018230 9796.ENSECAP00000018230 ENSECAP00000018230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]