SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 9796.ENSECAP00000018502 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  9796.ENSECAP00000018502
Domain Number 1 Region: 331-380
Classification Level Classification E-value
Superfamily UBA-like 1.62e-17
Family UBA domain 0.00012
Further Details:      
 
Domain Number 2 Region: 50-111
Classification Level Classification E-value
Superfamily RING/U-box 2.12e-17
Family ZZ domain 0.011
Further Details:      
 
Domain Number 3 Region: 4-35
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000701
Family PB1 domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 9796.ENSECAP00000018502
Sequence length 384
Comment (Equus caballus)
Sequence
XQAHYRDEDGDLVAFSSDEELTMALSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRNMV
HPNVICDGCNGPVVGTRYKCSVCPDYDLCASCEGKGMHREHSKLAFPSPFGHLSEGFSHS
RWLRKLKHGHFGWPGWEMGPPGNWSPRPARAGDGRPSPAVESASGPSEDPSVNFLKNVGE
SVAAALSPLGIEVDIDVEHGGKRSRLTSVSPGSSSTEEKCSSQPSSCSSDPNKPDGDMEG
TAQSLAEQMNKIALESGGQPEASTLLPEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSL
QMPGSEGPGSLDPSREGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRL
LQTKNYDIGAALDTIQYSKHPPPL
Download sequence
Identical sequences F6WA05
ENSECAP00000018502 ENSECAP00000018502 9796.ENSECAP00000018502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]